BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS312B05f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1254 + 35761046-35761162,35761332-35761416,35761877-357620... 46 2e-05 03_02_0790 - 11212540-11212698,11212777-11212873,11212974-112130... 29 2.3 >01_06_1254 + 35761046-35761162,35761332-35761416,35761877-35762017, 35762118-35762206,35762519-35762701,35763509-35763697, 35763808-35763938,35764023-35764125,35765123-35765308 Length = 407 Score = 46.0 bits (104), Expect = 2e-05 Identities = 40/108 (37%), Positives = 51/108 (47%), Gaps = 2/108 (1%) Frame = +2 Query: 203 MPPKKPSGASXXXXXXXXXXVIEDKTFGLKNKKGAKQ-QKFIQQVEKQVKSGGVHPVKPV 379 MPPKK A V+EDKTFGLKNK +K QK+ ++ E++ + K + Sbjct: 1 MPPKK--AAPSKADLAKKQKVVEDKTFGLKNKNKSKNVQKYKKKEEEKARE------KEL 52 Query: 380 EDXXXXXXXXXXXXXXXAALFKPVQTQ-KVEKGTDPKSVXCAFFKQGQ 520 D LFK +Q KV G DPKS+ C FFK GQ Sbjct: 53 ND-----------------LFKVAVSQPKVPVGVDPKSIVCEFFKVGQ 83 >03_02_0790 - 11212540-11212698,11212777-11212873,11212974-11213030, 11213291-11213379,11213463-11213549,11213820-11213935, 11214026-11214281,11214361-11214510,11214948-11215106, 11215456-11215493,11215972-11216063,11216528-11216682, 11217185-11217253 Length = 507 Score = 29.1 bits (62), Expect = 2.3 Identities = 11/43 (25%), Positives = 25/43 (58%) Frame = +2 Query: 56 FYLTVVFI*ISDDY*IYCLCGVHLLTRIYNF*LIVVLNPYKKV 184 F++ I +++DY +Y +C +H L + + + +LN Y ++ Sbjct: 228 FFVAFCCIVLNNDYTLYYICPMHTLFTLMVYGALGILNKYNEI 270 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,261,665 Number of Sequences: 37544 Number of extensions: 181092 Number of successful extensions: 292 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 286 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 292 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -