BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS312B05f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 23 2.5 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 22 3.3 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 22.6 bits (46), Expect = 2.5 Identities = 20/82 (24%), Positives = 34/82 (41%), Gaps = 1/82 (1%) Frame = +1 Query: 178 KGYKTKPNHAAQKAQ-WSQ*ENRAKKEGESY*GQNIWLEE*ERR*TAKVHSTS*KTSEER 354 K Y T N + + +R +E +N +E +RR K+H+ K EER Sbjct: 208 KKYATSSNSLRSRTHDFQHTSSRYSRERSCSRDRNREYKEKDRR-YEKLHNEKEKLLEER 266 Query: 355 WSTSSQTC*GQEKGKRTKTQRA 420 S +C + + K K + + Sbjct: 267 TSRKRYSCSREREQKSYKNENS 288 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 22.2 bits (45), Expect = 3.3 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = -1 Query: 440 TVPPTPSAL*VFVLFPFSCPQQV*LDVLHRSSLVFQ 333 T PPTP+ L F + +Q L++L V++ Sbjct: 825 TTPPTPNLLRYFASIATNPKEQAQLNLLASDPAVYE 860 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 121,158 Number of Sequences: 438 Number of extensions: 2477 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -