BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS312A10f (521 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8D341 Cluster: Bifunctional polymyxin resistance prote... 32 9.2 >UniRef50_Q8D341 Cluster: Bifunctional polymyxin resistance protein arnA [Includes: UDP-4-amino- 4-deoxy-L-arabinose formyltransferase (EC 2.1.2.-) (UDP-L-Ara4N formyltransferase) (ArnAFT); UDP-glucuronic acid oxidase, UDP-4-keto- hexauronic acid decarboxylating (EC 1.1.1.-) (UDP-GlcUA decarboxylase) (UDP-glucuronic acid dehydrogenase) (ArnADH)]; n=1; Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis|Rep: Bifunctional polymyxin resistance protein arnA [Includes: UDP-4-amino- 4-deoxy-L-arabinose formyltransferase (EC 2.1.2.-) (UDP-L-Ara4N formyltransferase) (ArnAFT); UDP-glucuronic acid oxidase, UDP-4-keto- hexauronic acid decarboxylating (EC 1.1.1.-) (UDP-GlcUA decarboxylase) (UDP-glucuronic acid dehydrogenase) (ArnADH)] - Wigglesworthia glossinidia brevipalpis Length = 654 Score = 31.9 bits (69), Expect = 9.2 Identities = 19/45 (42%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = -2 Query: 508 GTTQNGNV*AXVVINSKKISL-VLTIEYTTCNIINAHPKSNLFRI 377 GT N N ++I+ KK SL +L+ +YT CNI+N N+ RI Sbjct: 257 GTILNFN---PLIISCKKKSLEILSAQYTECNILNKRNIENISRI 298 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 392,912,002 Number of Sequences: 1657284 Number of extensions: 5998999 Number of successful extensions: 12630 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 12375 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12624 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 32619212418 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -