SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ovS312A10f
         (521 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q8D341 Cluster: Bifunctional polymyxin resistance prote...    32   9.2  

>UniRef50_Q8D341 Cluster: Bifunctional polymyxin resistance protein
           arnA [Includes: UDP-4-amino- 4-deoxy-L-arabinose
           formyltransferase (EC 2.1.2.-) (UDP-L-Ara4N
           formyltransferase) (ArnAFT); UDP-glucuronic acid
           oxidase, UDP-4-keto- hexauronic acid decarboxylating (EC
           1.1.1.-) (UDP-GlcUA decarboxylase) (UDP-glucuronic acid
           dehydrogenase) (ArnADH)]; n=1; Wigglesworthia
           glossinidia endosymbiont of Glossina brevipalpis|Rep:
           Bifunctional polymyxin resistance protein arnA
           [Includes: UDP-4-amino- 4-deoxy-L-arabinose
           formyltransferase (EC 2.1.2.-) (UDP-L-Ara4N
           formyltransferase) (ArnAFT); UDP-glucuronic acid
           oxidase, UDP-4-keto- hexauronic acid decarboxylating (EC
           1.1.1.-) (UDP-GlcUA decarboxylase) (UDP-glucuronic acid
           dehydrogenase) (ArnADH)] - Wigglesworthia glossinidia
           brevipalpis
          Length = 654

 Score = 31.9 bits (69), Expect = 9.2
 Identities = 19/45 (42%), Positives = 27/45 (60%), Gaps = 1/45 (2%)
 Frame = -2

Query: 508 GTTQNGNV*AXVVINSKKISL-VLTIEYTTCNIINAHPKSNLFRI 377
           GT  N N    ++I+ KK SL +L+ +YT CNI+N     N+ RI
Sbjct: 257 GTILNFN---PLIISCKKKSLEILSAQYTECNILNKRNIENISRI 298


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 392,912,002
Number of Sequences: 1657284
Number of extensions: 5998999
Number of successful extensions: 12630
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 12375
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12624
length of database: 575,637,011
effective HSP length: 95
effective length of database: 418,195,031
effective search space used: 32619212418
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -