BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS312A10f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 23 1.4 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 23 1.4 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 23 1.4 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 21 5.8 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 23.4 bits (48), Expect = 1.4 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = +3 Query: 51 YFCITWFSFMYCSVAVCRRSLLVLCA*VFD 140 + C W + C V C S+L LCA D Sbjct: 107 HLCKLWLT---CDVLCCTASILNLCAIALD 133 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 23.4 bits (48), Expect = 1.4 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = +3 Query: 51 YFCITWFSFMYCSVAVCRRSLLVLCA*VFD 140 + C W + C V C S+L LCA D Sbjct: 107 HLCKLWLT---CDVLCCTASILNLCAIALD 133 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 23.4 bits (48), Expect = 1.4 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = +3 Query: 51 YFCITWFSFMYCSVAVCRRSLLVLCA*VFD 140 + C W + C V C S+L LCA D Sbjct: 107 HLCKLWLT---CDVLCCTASILNLCAIALD 133 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 21.4 bits (43), Expect = 5.8 Identities = 9/38 (23%), Positives = 18/38 (47%) Frame = -2 Query: 469 INSKKISLVLTIEYTTCNIINAHPKSNLFRIGIWIDFD 356 + ++ LVL+ T II+ K+ L +W+ + Sbjct: 42 VGNESEPLVLSFGLTLMQIIDVDEKNQLLITNLWLKLE 79 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 120,893 Number of Sequences: 438 Number of extensions: 2125 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -