BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS312A09f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0160 - 26382377-26382874 28 5.2 01_05_0668 - 24147412-24147618,24148019-24148286,24149506-241497... 27 6.9 09_02_0250 + 6266818-6267029,6267230-6267287,6267999-6268118,627... 27 9.1 01_01_0886 - 6970112-6970225,6970357-6970473,6970567-6970635,697... 27 9.1 >02_05_0160 - 26382377-26382874 Length = 165 Score = 27.9 bits (59), Expect = 5.2 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -2 Query: 175 ERMMCERHGCSASSLSRTTPPLG 107 ER C RHG +SS T PP G Sbjct: 33 ERCRCHRHGAWSSSTMITPPPRG 55 >01_05_0668 - 24147412-24147618,24148019-24148286,24149506-24149728, 24149822-24149996 Length = 290 Score = 27.5 bits (58), Expect = 6.9 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = -1 Query: 401 YGSLLHIFVAHKLPALISIELFRFII 324 YG L IF+ L +++ IE+FR++I Sbjct: 211 YGYSLFIFIPASLLSIVPIEIFRWVI 236 >09_02_0250 + 6266818-6267029,6267230-6267287,6267999-6268118, 6272359-6272511,6273381-6273586,6274280-6274733, 6276573-6276610,6276923-6277046,6277184-6277246, 6277350-6277412,6277526-6278152,6278267-6278294, 6278373-6278413,6278689-6278851,6278987-6279039, 6279217-6279262,6279373-6279444,6279578-6279741, 6279968-6280099,6280249-6280565,6280721-6280892, 6281009-6281107,6281275-6281349,6281446-6281504, 6281647-6281836,6281982-6282020 Length = 1255 Score = 27.1 bits (57), Expect = 9.1 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = -1 Query: 467 YSRHVLLSNDIKCDDINNLLLTYGSLLHIFVAHK 366 +S V+L N+ DDINN+ + Y + IF HK Sbjct: 1194 WSPRVVLPNEFSKDDINNIRVQYTN--KIFFHHK 1225 >01_01_0886 - 6970112-6970225,6970357-6970473,6970567-6970635, 6970711-6970849,6970964-6971532,6971799-6971966, 6972097-6972184,6972260-6972818,6972924-6973024, 6973113-6973155,6973845-6973938,6974160-6974215, 6974460-6974581,6975306-6975517 Length = 816 Score = 27.1 bits (57), Expect = 9.1 Identities = 11/39 (28%), Positives = 23/39 (58%) Frame = -1 Query: 455 VLLSNDIKCDDINNLLLTYGSLLHIFVAHKLPALISIEL 339 VL ND++CDD+ ++ L+ +L ++ + + +S L Sbjct: 339 VLAENDLECDDLGSICLSDTMVLGRYIEEIVVSAVSYHL 377 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,990,113 Number of Sequences: 37544 Number of extensions: 145955 Number of successful extensions: 202 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 199 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 202 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -