BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS312A09f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34954| Best HMM Match : HSBP1 (HMM E-Value=5.6) 27 7.1 SB_7788| Best HMM Match : PAN (HMM E-Value=0.0013) 27 9.4 >SB_34954| Best HMM Match : HSBP1 (HMM E-Value=5.6) Length = 106 Score = 27.5 bits (58), Expect = 7.1 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -2 Query: 400 MAVYCIYSSPTSFRL*SQSSYLDLLFVSVRNS 305 ++VYC SS F L S ++Y+D + +RN+ Sbjct: 41 ISVYCGQSSGQQFSLESLNAYIDAMVRKIRNA 72 >SB_7788| Best HMM Match : PAN (HMM E-Value=0.0013) Length = 294 Score = 27.1 bits (57), Expect = 9.4 Identities = 10/41 (24%), Positives = 24/41 (58%) Frame = +2 Query: 203 FTIIRNVSNN*IIKSYIYKSDYVKCFLLFQIQLKTISY*YE 325 FT++ +++SY + ++++C +L Q K +SY ++ Sbjct: 26 FTLMDRYLPGHVLESYSSRQEWIQCTMLCQDMTKCVSYNFD 66 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,274,603 Number of Sequences: 59808 Number of extensions: 186954 Number of successful extensions: 257 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 238 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 257 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -