BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS312A08f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY345586-1|AAR09143.1| 427|Anopheles gambiae myosuppressin rece... 26 0.88 AF457547-1|AAL68777.1| 163|Anopheles gambiae selenoprotein prot... 25 2.0 >AY345586-1|AAR09143.1| 427|Anopheles gambiae myosuppressin receptor protein. Length = 427 Score = 25.8 bits (54), Expect = 0.88 Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = -1 Query: 182 FYSLYSQIFIVLLHTISI*VYLH-AIFYYVHILYSSR 75 +Y ++ IF + HTISI + + AI+ Y+ + Y R Sbjct: 129 WYIMFHSIFAQICHTISIWLTVTLAIWRYIAVAYPQR 165 >AF457547-1|AAL68777.1| 163|Anopheles gambiae selenoprotein protein. Length = 163 Score = 24.6 bits (51), Expect = 2.0 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +3 Query: 324 VTKLLEIKYTNTDTVQEFQE 383 V + L I NTDTVQEF E Sbjct: 127 VKETLSINKWNTDTVQEFFE 146 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 379,444 Number of Sequences: 2352 Number of extensions: 5240 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -