BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS312A08f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435328-1|ABD92643.1| 143|Apis mellifera OBP11 protein. 22 4.4 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 21 7.7 >DQ435328-1|ABD92643.1| 143|Apis mellifera OBP11 protein. Length = 143 Score = 21.8 bits (44), Expect = 4.4 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = -1 Query: 431 KVRSVFVCSLYTILVFLLKLLYG 363 K +++ SLY L+ + L+YG Sbjct: 2 KAAEIWLVSLYWYLILQIALVYG 24 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 21.0 bits (42), Expect = 7.7 Identities = 9/34 (26%), Positives = 19/34 (55%) Frame = -1 Query: 140 TISI*VYLHAIFYYVHILYSSRI**VLCVSIYYI 39 T I + +FY V+++ + + LCV ++Y+ Sbjct: 224 TFYIIIRRKTLFYTVNLILPTVLISFLCVLVFYL 257 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 106,046 Number of Sequences: 438 Number of extensions: 1723 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -