BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS312A05f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_04_0046 - 17482792-17483124 27 6.9 04_04_1479 - 33888521-33888853 27 6.9 02_05_1204 + 34936696-34936698,34936809-34936944,34937794-349378... 27 6.9 >05_04_0046 - 17482792-17483124 Length = 110 Score = 27.5 bits (58), Expect = 6.9 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -1 Query: 278 NYGSYKVRCAICRTIGKETSNAC 210 NYGS++ RC IC +G + C Sbjct: 50 NYGSFQGRCVICGGVGISDAYYC 72 >04_04_1479 - 33888521-33888853 Length = 110 Score = 27.5 bits (58), Expect = 6.9 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -1 Query: 278 NYGSYKVRCAICRTIGKETSNAC 210 NYGS++ RC IC +G + C Sbjct: 50 NYGSFQGRCVICGGVGISDAYYC 72 >02_05_1204 + 34936696-34936698,34936809-34936944,34937794-34937895, 34938153-34938199 Length = 95 Score = 27.5 bits (58), Expect = 6.9 Identities = 18/64 (28%), Positives = 29/64 (45%) Frame = -1 Query: 521 HSPKPQCARRVFETMXQFCFHCRFCSANFTA*HFFSVFVYRKT*RVTSSMCWSR*VLKSY 342 H+ +C RR F C C + +A + +SV R+ T M + R V K + Sbjct: 16 HTLCVRCGRRSFHLQKSTCSSCGYPAARIRK-YNWSVKAIRRKTTGTGRMRYLRHVPKRF 74 Query: 341 KNNY 330 K+N+ Sbjct: 75 KSNF 78 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,511,943 Number of Sequences: 37544 Number of extensions: 194275 Number of successful extensions: 375 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 367 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 375 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -