BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS312A02f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 23 1.2 EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 23 1.2 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 22 2.9 AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 22 2.9 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 22 3.8 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 22 3.8 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 23.4 bits (48), Expect = 1.2 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -1 Query: 239 LTSLLYTCCRSPPICIEMMRRWSSSLH-HTRNVLFSLW*MP 120 + S + C SPP E++RR+ + T ++ S W +P Sbjct: 364 INSKMIADCESPPAADELLRRFHEIRYMSTIDLRSSYWQIP 404 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 23.4 bits (48), Expect = 1.2 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = +1 Query: 151 LVWCNEEDHLRIISMQMGGDLQQVYKRLVSAVNEIEKKIP 270 ++W E D R +S L+ +++ L + NEI + +P Sbjct: 355 MIWSIETDDFRGVSGTKYPILKAIHQTLGGSSNEIVEPVP 394 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 22.2 bits (45), Expect = 2.9 Identities = 8/18 (44%), Positives = 14/18 (77%) Frame = +3 Query: 213 AAGVQEAGERRQRDREED 266 A GVQ+AG++ + ++ED Sbjct: 67 AGGVQQAGKKPENVKKED 84 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 22.2 bits (45), Expect = 2.9 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = +1 Query: 121 GIYHNENKTFLVWCNEEDHLRIISMQMGGD 210 G HN F+ + ++ DH + S + GD Sbjct: 360 GDLHNMGHVFISYIHDPDHRHLESFGVMGD 389 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 21.8 bits (44), Expect = 3.8 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +1 Query: 277 HHDRLGFLTFCPTNLGTTVR 336 ++D + F+T CP G T R Sbjct: 211 YYDGVPFVTQCPIQQGNTFR 230 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 21.8 bits (44), Expect = 3.8 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +1 Query: 277 HHDRLGFLTFCPTNLGTTVR 336 ++D + F+T CP G T R Sbjct: 211 YYDGVPFVTQCPIQQGNTFR 230 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 75,740 Number of Sequences: 336 Number of extensions: 1328 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -