BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS312A02f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L76038-1|AAC27383.1| 683|Anopheles gambiae prophenoloxidase pro... 23 6.2 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 23 6.2 AF031626-1|AAD01936.1| 683|Anopheles gambiae prophenoloxidase p... 23 6.2 AJ302655-1|CAC35520.1| 332|Anopheles gambiae gSG5 protein protein. 23 8.2 AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 23 8.2 >L76038-1|AAC27383.1| 683|Anopheles gambiae prophenoloxidase protein. Length = 683 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = +1 Query: 121 GIYHNENKTFLVWCNEEDHLRIISMQMGGDL 213 G HN F+ + ++ DH + S + GD+ Sbjct: 361 GDMHNMGHVFISYAHDPDHRHLESFGVMGDV 391 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 23.0 bits (47), Expect = 6.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 225 QEAGERRQRDREEDPVLAPRPARLPHVLP 311 +EA R+R+RE + +PH LP Sbjct: 519 REAARERERERERERERERMMHMMPHSLP 547 Score = 22.6 bits (46), Expect = 8.2 Identities = 11/39 (28%), Positives = 17/39 (43%) Frame = +3 Query: 207 RPAAGVQEAGERRQRDREEDPVLAPRPARLPHVLPDQPG 323 R +E R+R+RE + ++ P LP PG Sbjct: 517 REREAARERERERERERERERMMHMMPHSLPRPFFSIPG 555 >AF031626-1|AAD01936.1| 683|Anopheles gambiae prophenoloxidase protein. Length = 683 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = +1 Query: 121 GIYHNENKTFLVWCNEEDHLRIISMQMGGDL 213 G HN F+ + ++ DH + S + GD+ Sbjct: 361 GDMHNMGHVFISYAHDPDHRHLESFGVMGDV 391 >AJ302655-1|CAC35520.1| 332|Anopheles gambiae gSG5 protein protein. Length = 332 Score = 22.6 bits (46), Expect = 8.2 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -1 Query: 341 EARTVVPRLVGQNVRKPS 288 E T +PR+V QN+ +P+ Sbjct: 83 ENETDIPRMVVQNISRPN 100 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 22.6 bits (46), Expect = 8.2 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -1 Query: 164 LHHTRNVLFSLW*MPRPVGQKRQALAA 84 L H R V F++W +P+ + R A A Sbjct: 895 LDHNRLVEFNVWLLPKQLNDIRLAFNA 921 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 350,021 Number of Sequences: 2352 Number of extensions: 5748 Number of successful extensions: 24 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -