BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS311H12f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 27 0.076 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 22 3.8 AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 21 8.7 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 27.5 bits (58), Expect = 0.076 Identities = 20/59 (33%), Positives = 24/59 (40%), Gaps = 1/59 (1%) Frame = -3 Query: 474 CANGC-GYDCASNYDGGNETWTCACDRNDSCMAMRGDHIAPSEREVPCRPTFVRPSCPG 301 C +G GY C N D + AC N +C+ G E C P FV P C G Sbjct: 248 CPSGTLGYICEINVD---DCRPGACHNNGTCLDKVGGF------ECKCPPGFVGPRCEG 297 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 21.8 bits (44), Expect = 3.8 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +1 Query: 352 RWRDMVAPHRHTGVV 396 RWRD + H+GVV Sbjct: 310 RWRDRIYDAIHSGVV 324 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 20.6 bits (41), Expect = 8.7 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = -3 Query: 252 YFPLCTDLWECRYHQLLRTFRKRGVSLQAS 163 +F +C D ++ FRKR V+ + S Sbjct: 77 FFAICCDFIALIVVNIVHVFRKRRVNYKDS 106 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 105,471 Number of Sequences: 336 Number of extensions: 2213 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -