BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS311H04f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking p... 25 1.2 AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. 25 1.5 DQ137802-1|AAZ78363.1| 265|Anopheles gambiae female-specific do... 24 3.6 DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doub... 24 3.6 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 24 3.6 DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. 23 6.2 AY805323-1|AAV66543.1| 459|Anopheles gambiae beta subunit-GABA-... 23 6.2 AM085517-1|CAJ30215.1| 339|Anopheles gambiae putative angiotens... 23 6.2 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 23 6.2 AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transc... 23 6.2 >AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking protein. Length = 932 Score = 25.4 bits (53), Expect = 1.2 Identities = 22/69 (31%), Positives = 25/69 (36%), Gaps = 2/69 (2%) Frame = +1 Query: 244 PAEAHRDSGEEPASGQRRCRSGESPPEPLGRSRTLRQDSDEAHDDGRKESTAP--DRSYR 417 PA D+ G+ G S G + D DE H GRK AP R Sbjct: 616 PAGYREDTTGSYKYGKLSSSGGASSTTHSGAPSRSQSDEDEQHSVGRK-GLAPLIQRGEG 674 Query: 418 SGEGKEQIP 444 S EGK P Sbjct: 675 SFEGKAMPP 683 >AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. Length = 615 Score = 25.0 bits (52), Expect = 1.5 Identities = 14/60 (23%), Positives = 25/60 (41%), Gaps = 3/60 (5%) Frame = -1 Query: 302 RQRLCPEAGSSPESRCASAGSNQTSRYRRIKTSGSSQWQRLQ---QTEAQSFHWCRRHGD 132 + ++ P S C + R R++ Q ++ QT +Q+ HW + HGD Sbjct: 177 KDKVGPRVLESAAKFCEVLKGREMQRQFRLEQEQLQQMRKQSVDTQTLSQANHWLKSHGD 236 >DQ137802-1|AAZ78363.1| 265|Anopheles gambiae female-specific doublesex protein protein. Length = 265 Score = 23.8 bits (49), Expect = 3.6 Identities = 16/50 (32%), Positives = 22/50 (44%) Frame = +1 Query: 181 RRCH*EDPEVFIRRYREV*FEPAEAHRDSGEEPASGQRRCRSGESPPEPL 330 R CH E + R R + + A + +E QR GE PPEP+ Sbjct: 63 RTCHCEKCCLTAERQRVMALQTALRRAQTQDE----QRALNEGEVPPEPV 108 >DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doublesex protein protein. Length = 622 Score = 23.8 bits (49), Expect = 3.6 Identities = 16/50 (32%), Positives = 22/50 (44%) Frame = +1 Query: 181 RRCH*EDPEVFIRRYREV*FEPAEAHRDSGEEPASGQRRCRSGESPPEPL 330 R CH E + R R + + A + +E QR GE PPEP+ Sbjct: 63 RTCHCEKCCLTAERQRVMALQTALRRAQTQDE----QRALNEGEVPPEPV 108 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 23.8 bits (49), Expect = 3.6 Identities = 8/28 (28%), Positives = 18/28 (64%) Frame = -2 Query: 493 RLRVLQLSGIEVLDAVQEFVLFLLRFDS 410 R+++ L +E+++ +Q+F F FD+ Sbjct: 7 RVKMFNLKRVEIMNTLQDFEEFTKSFDA 34 >DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. Length = 847 Score = 23.0 bits (47), Expect = 6.2 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 4/52 (7%) Frame = +1 Query: 262 DSGEEPASGQRRCRSGESPPE----PLGRSRTLRQDSDEAHDDGRKESTAPD 405 + G+E + G+RR R G P+ P+G Q S + + RK S D Sbjct: 46 NEGDEGSGGRRRGRMGGKQPKDYSAPIGFIAGGIQQSGKKPEKDRKPSDEDD 97 >AY805323-1|AAV66543.1| 459|Anopheles gambiae beta subunit-GABA-A-gated chloride channelprotein. Length = 459 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/32 (28%), Positives = 18/32 (56%) Frame = -2 Query: 478 QLSGIEVLDAVQEFVLFLLRFDSFDRGQWILF 383 ++ + V+D V+F + F +F+ G WI + Sbjct: 426 KIKDVNVIDKYSR-VIFPVSFAAFNAGYWIFY 456 >AM085517-1|CAJ30215.1| 339|Anopheles gambiae putative angiotensin converting enzymeprecursor protein. Length = 339 Score = 23.0 bits (47), Expect = 6.2 Identities = 12/35 (34%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +1 Query: 304 SGESPPE--PLGRSRTLRQDSDEAHDDGRKESTAP 402 +GE+ P PLG + D HD R E P Sbjct: 47 NGEASPTRVPLGVDGVVSGDGSSVHDRSRSERFGP 81 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 23.0 bits (47), Expect = 6.2 Identities = 19/81 (23%), Positives = 25/81 (30%), Gaps = 1/81 (1%) Frame = +1 Query: 280 ASGQR-RCRSGESPPEPLGRSRTLRQDSDEAHDDGRKESTAPDRSYRSGEGKEQIPERHR 456 A G R R RSG RSR+ Q + R S + ++ R Sbjct: 1112 AKGSRSRSRSGSGGSRSRSRSRSRSQSAGSRKSGSRSRSRSGSQASRGSRRSRSRSRSRS 1171 Query: 457 ELRSH*AEAHGDVRKEPAPHK 519 RS G + P K Sbjct: 1172 GSRSRSRSGSGSRQASPISRK 1192 >AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transcription factor pannier protein. Length = 537 Score = 23.0 bits (47), Expect = 6.2 Identities = 18/71 (25%), Positives = 27/71 (38%), Gaps = 1/71 (1%) Frame = -1 Query: 335 RPRGSGGLSPLRQRLCPEAGSSPESRCASAGSNQTSRYRRIKT-SGSSQWQRLQQTEAQS 159 +P+ +GG + G + G QT R K +GS + Q L +S Sbjct: 227 KPKKTGGSGGSADVMALVGGKKDDGGIGD-GLLQTDRNGNSKNLTGSPKSQNLSSPTIRS 285 Query: 158 FHWCRRHGDSW 126 H HG S+ Sbjct: 286 LHISPHHGQSY 296 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 514,831 Number of Sequences: 2352 Number of extensions: 10537 Number of successful extensions: 33 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -