BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS311H01f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ459959-1|CAD31058.1| 462|Anopheles gambiae dopachrome convers... 46 1e-06 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 25 1.2 AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 24 3.6 AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 24 3.6 AF364131-1|AAL35507.1| 378|Anopheles gambiae putative odorant r... 24 3.6 Z22930-4|CAA80516.1| 267|Anopheles gambiae Trypsinogen precurso... 23 4.7 DQ518577-1|ABF66619.1| 318|Anopheles gambiae putative secreted ... 23 8.2 >AJ459959-1|CAD31058.1| 462|Anopheles gambiae dopachrome conversion enzyme protein. Length = 462 Score = 45.6 bits (103), Expect = 1e-06 Identities = 33/121 (27%), Positives = 58/121 (47%), Gaps = 10/121 (8%) Frame = +3 Query: 156 VRQWAELEFVFPNEEARSYALEKRFYVPGSSVPIDVDVQHRSGKKSRIFVTIPRFDEGRP 335 V +W +E+ P E + + Y+P ++P+ V H K+R+FV + R G P Sbjct: 26 VLKWQRVEYDVPAEVLQ----RENGYIPIGNIPMGA-VHH----KNRVFVAVARRRWGIP 76 Query: 336 VTFGTVD-----DEGRIVA--YPDYSWHE---DQGQNCGGLTSVFRVAIDECNRLWIMDA 485 T VD ++ YP+++ +E D + + +V+R +D C+RLW +D Sbjct: 77 STLNVVDLSPPFPNTNVILKPYPNFALNELRADLQPDANRIVTVYRPRVDRCDRLWFVDT 136 Query: 486 G 488 G Sbjct: 137 G 137 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 25.4 bits (53), Expect = 1.2 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -2 Query: 217 NAYDRASSFGNTNSSSAHCL 158 NA RA SFG TN+ CL Sbjct: 549 NAARRAMSFGRTNNRDRRCL 568 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 23.8 bits (49), Expect = 3.6 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +3 Query: 393 WHEDQGQNCGGLTSVFRVAIDECNRLWIM 479 WHE++ + L S+ R+ D+C R M Sbjct: 222 WHENKEELMEFLKSILRLDEDQCARRMAM 250 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 23.8 bits (49), Expect = 3.6 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -3 Query: 195 RSETRTPVPPIASPRGDY 142 R+ T P+P A P GDY Sbjct: 801 RTPTPPPLPATAEPMGDY 818 >AF364131-1|AAL35507.1| 378|Anopheles gambiae putative odorant receptor Or2 protein. Length = 378 Score = 23.8 bits (49), Expect = 3.6 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = +3 Query: 291 SRIFVTIPRFDEGRPVTFGTVDDEGRIVAYPDY 389 S FVT P F GR + +G ++A P Y Sbjct: 131 SACFVTYPLFVPGRGLPYGVTIPGVDVLATPTY 163 >Z22930-4|CAA80516.1| 267|Anopheles gambiae Trypsinogen precursor of ANTRYP7 protein. Length = 267 Score = 23.4 bits (48), Expect = 4.7 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +3 Query: 300 FVTIPRFDEGRPVTFGTVDDEGRIVAYPDY 389 F R R + GTV + RIV +P+Y Sbjct: 90 FTLTVRLGSSRHASSGTVVNVARIVEHPNY 119 >DQ518577-1|ABF66619.1| 318|Anopheles gambiae putative secreted carbonic anhydrase protein. Length = 318 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -1 Query: 491 LSGVHYPETIAFINRNSKHRS*SSAV 414 L+ + YP + I+RN K++S A+ Sbjct: 144 LNDIRYPLEMHIIHRNKKYKSVGEAL 169 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 602,895 Number of Sequences: 2352 Number of extensions: 13122 Number of successful extensions: 29 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -