BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS311H01f (521 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC041331-1|AAH41331.2| 1121|Homo sapiens ZNF335 protein protein. 32 1.4 BC032446-1|AAH32446.1| 767|Homo sapiens cold shock domain conta... 31 2.4 AY358546-1|AAQ88910.1| 592|Homo sapiens ROR-alpha protein. 31 2.4 AY049788-1|AAL15445.1| 708|Homo sapiens NRAS-related protein pr... 31 2.4 AL162458-3|CAC10457.1| 1342|Homo sapiens zinc finger protein 335... 31 2.4 AL096773-5|CAI18825.1| 798|Homo sapiens cold shock domain conta... 31 2.4 AL096773-4|CAI18826.1| 767|Homo sapiens cold shock domain conta... 31 2.4 AK026157-1|BAB15379.1| 829|Homo sapiens protein ( Homo sapiens ... 31 2.4 AK022528-1|BAB14080.1| 767|Homo sapiens protein ( Homo sapiens ... 31 2.4 AK022516-1|BAB14073.1| 767|Homo sapiens protein ( Homo sapiens ... 31 2.4 AF502591-1|AAQ07460.1| 982|Homo sapiens BRCC1 protein. 31 2.4 AF395833-1|AAN09900.1| 1342|Homo sapiens zinc-finger/leucine-zip... 31 2.4 AF070542-1|AAC28634.1| 467|Homo sapiens unknown protein. 31 2.4 AB020692-1|BAA74908.2| 826|Homo sapiens KIAA0885 protein protein. 31 2.4 BC126405-1|AAI26406.1| 1613|Homo sapiens low density lipoprotein... 29 7.5 BC117136-1|AAI17137.1| 1613|Homo sapiens low density lipoprotein... 29 7.5 AF074264-1|AAC33006.1| 1613|Homo sapiens LDL receptor-related pr... 29 7.5 AB209683-1|BAD92920.1| 1477|Homo sapiens low density lipoprotein... 29 7.5 AL832320-1|CAD38615.1| 465|Homo sapiens hypothetical protein pr... 29 9.9 AJ277365-1|CAC10539.1| 796|Homo sapiens polyglutamine-containin... 29 9.9 AB058768-1|BAB47494.1| 723|Homo sapiens KIAA1865 protein protein. 29 9.9 >BC041331-1|AAH41331.2| 1121|Homo sapiens ZNF335 protein protein. Length = 1121 Score = 31.9 bits (69), Expect = 1.4 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = -3 Query: 267 RRHQLAPRTRVRKIVSLMHMTELLRSETRTPVPPIASP 154 RRH P +R R SL + EL + + P PP +SP Sbjct: 489 RRHPEEPPSRRRPFFSLQQIEELKQQHSAAPGPPTSSP 526 >BC032446-1|AAH32446.1| 767|Homo sapiens cold shock domain containing E1, RNA-binding protein. Length = 767 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/67 (17%), Positives = 32/67 (47%) Frame = +3 Query: 138 KNNLRVVRQWAELEFVFPNEEARSYALEKRFYVPGSSVPIDVDVQHRSGKKSRIFVTIPR 317 K +L ++ ++EF + + A + R G+ + D+ ++H G +++ +P Sbjct: 186 KGDLETLQPGDDVEFTIKDRNGKEVATDVRLLPQGTVIFEDISIEHFEGTVTKVIPKVPS 245 Query: 318 FDEGRPV 338 ++ P+ Sbjct: 246 KNQNDPL 252 >AY358546-1|AAQ88910.1| 592|Homo sapiens ROR-alpha protein. Length = 592 Score = 31.1 bits (67), Expect = 2.4 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = -2 Query: 361 SSSTVPNVTGRPSSKRGIVTNIRDFLPDLCCTSTSI 254 S+STVPN+T P++ + T + PD+ S S+ Sbjct: 421 STSTVPNMTDAPTAPKAGTTTVAPSAPDISANSRSL 456 >AY049788-1|AAL15445.1| 708|Homo sapiens NRAS-related protein protein. Length = 708 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/67 (17%), Positives = 32/67 (47%) Frame = +3 Query: 138 KNNLRVVRQWAELEFVFPNEEARSYALEKRFYVPGSSVPIDVDVQHRSGKKSRIFVTIPR 317 K +L ++ ++EF + + A + R G+ + D+ ++H G +++ +P Sbjct: 186 KGDLETLQPGDDVEFTIKDRNGKEVATDVRLLPQGTVIFEDISIEHFEGTVTKVIPKVPS 245 Query: 318 FDEGRPV 338 ++ P+ Sbjct: 246 KNQNDPL 252 >AL162458-3|CAC10457.1| 1342|Homo sapiens zinc finger protein 335 protein. Length = 1342 Score = 31.1 bits (67), Expect = 2.4 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = -3 Query: 267 RRHQLAPRTRVRKIVSLMHMTELLRSETRTPVPPIASP 154 RRH P +R R SL + EL + + P PP +SP Sbjct: 710 RRHPEEPPSRRRPFFSLQQIEELKQQHSAAPGPPPSSP 747 >AL096773-5|CAI18825.1| 798|Homo sapiens cold shock domain containing E1, RNA-binding protein. Length = 798 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/67 (17%), Positives = 32/67 (47%) Frame = +3 Query: 138 KNNLRVVRQWAELEFVFPNEEARSYALEKRFYVPGSSVPIDVDVQHRSGKKSRIFVTIPR 317 K +L ++ ++EF + + A + R G+ + D+ ++H G +++ +P Sbjct: 217 KGDLETLQPGDDVEFTIKDRNGKEVATDVRLLPQGTVIFEDISIEHFEGTVTKVIPKVPS 276 Query: 318 FDEGRPV 338 ++ P+ Sbjct: 277 KNQNDPL 283 >AL096773-4|CAI18826.1| 767|Homo sapiens cold shock domain containing E1, RNA-binding protein. Length = 767 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/67 (17%), Positives = 32/67 (47%) Frame = +3 Query: 138 KNNLRVVRQWAELEFVFPNEEARSYALEKRFYVPGSSVPIDVDVQHRSGKKSRIFVTIPR 317 K +L ++ ++EF + + A + R G+ + D+ ++H G +++ +P Sbjct: 186 KGDLETLQPGDDVEFTIKDRNGKEVATDVRLLPQGTVIFEDISIEHFEGTVTKVIPKVPS 245 Query: 318 FDEGRPV 338 ++ P+ Sbjct: 246 KNQNDPL 252 >AK026157-1|BAB15379.1| 829|Homo sapiens protein ( Homo sapiens cDNA: FLJ22504 fis, clone HRC11430. ). Length = 829 Score = 31.1 bits (67), Expect = 2.4 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = -3 Query: 267 RRHQLAPRTRVRKIVSLMHMTELLRSETRTPVPPIASP 154 RRH P +R R SL + EL + + P PP +SP Sbjct: 197 RRHPEEPPSRRRPFFSLQQIEELKQQHSAAPGPPPSSP 234 >AK022528-1|BAB14080.1| 767|Homo sapiens protein ( Homo sapiens cDNA FLJ12466 fis, clone NT2RM1000826, highly similar to UNR PROTEIN. ). Length = 767 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/67 (17%), Positives = 32/67 (47%) Frame = +3 Query: 138 KNNLRVVRQWAELEFVFPNEEARSYALEKRFYVPGSSVPIDVDVQHRSGKKSRIFVTIPR 317 K +L ++ ++EF + + A + R G+ + D+ ++H G +++ +P Sbjct: 186 KGDLETLQPGDDVEFTIKDRNGKEVATDVRLLPQGTVIFEDISIEHFEGTVTKVIPKVPS 245 Query: 318 FDEGRPV 338 ++ P+ Sbjct: 246 KNQNDPL 252 >AK022516-1|BAB14073.1| 767|Homo sapiens protein ( Homo sapiens cDNA FLJ12454 fis, clone NT2RM1000555, highly similar to UNR PROTEIN. ). Length = 767 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/67 (17%), Positives = 32/67 (47%) Frame = +3 Query: 138 KNNLRVVRQWAELEFVFPNEEARSYALEKRFYVPGSSVPIDVDVQHRSGKKSRIFVTIPR 317 K +L ++ ++EF + + A + R G+ + D+ ++H G +++ +P Sbjct: 186 KGDLETLQPGDDVEFTIKDRNGKEVATDVRLLPQGTVIFEDISIEHFEGTVTKVIPKVPS 245 Query: 318 FDEGRPV 338 ++ P+ Sbjct: 246 KNQNDPL 252 >AF502591-1|AAQ07460.1| 982|Homo sapiens BRCC1 protein. Length = 982 Score = 31.1 bits (67), Expect = 2.4 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = -2 Query: 361 SSSTVPNVTGRPSSKRGIVTNIRDFLPDLCCTSTSI 254 S+STVPN+T P++ + T + PD+ S S+ Sbjct: 421 STSTVPNMTDAPTAPKAGTTTVAPSAPDISANSRSL 456 >AF395833-1|AAN09900.1| 1342|Homo sapiens zinc-finger/leucine-zipper co-transducer NIF1 protein. Length = 1342 Score = 31.1 bits (67), Expect = 2.4 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = -3 Query: 267 RRHQLAPRTRVRKIVSLMHMTELLRSETRTPVPPIASP 154 RRH P +R R SL + EL + + P PP +SP Sbjct: 710 RRHPEEPPSRRRPFFSLQQIEELKQQHSAAPGPPPSSP 747 >AF070542-1|AAC28634.1| 467|Homo sapiens unknown protein. Length = 467 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/67 (17%), Positives = 32/67 (47%) Frame = +3 Query: 138 KNNLRVVRQWAELEFVFPNEEARSYALEKRFYVPGSSVPIDVDVQHRSGKKSRIFVTIPR 317 K +L ++ ++EF + + A + R G+ + D+ ++H G +++ +P Sbjct: 186 KGDLETLQPGDDVEFTIKDRNGKEVATDVRLLPQGTVIFEDISIEHFEGTVTKVIPKVPS 245 Query: 318 FDEGRPV 338 ++ P+ Sbjct: 246 KNQNDPL 252 >AB020692-1|BAA74908.2| 826|Homo sapiens KIAA0885 protein protein. Length = 826 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/67 (17%), Positives = 32/67 (47%) Frame = +3 Query: 138 KNNLRVVRQWAELEFVFPNEEARSYALEKRFYVPGSSVPIDVDVQHRSGKKSRIFVTIPR 317 K +L ++ ++EF + + A + R G+ + D+ ++H G +++ +P Sbjct: 245 KGDLETLQPGDDVEFTIKDRNGKEVATDVRLLPQGTVIFEDISIEHFEGTVTKVIPKVPS 304 Query: 318 FDEGRPV 338 ++ P+ Sbjct: 305 KNQNDPL 311 >BC126405-1|AAI26406.1| 1613|Homo sapiens low density lipoprotein receptor-related protein 6 protein. Length = 1613 Score = 29.5 bits (63), Expect = 7.5 Identities = 16/56 (28%), Positives = 26/56 (46%) Frame = -3 Query: 252 APRTRVRKIVSLMHMTELLRSETRTPVPPIASPRGDYSSLRDRANSTPNNMTVEKT 85 AP R+ + + T L ++ PVPP +PR Y S + S P + E++ Sbjct: 1542 APSRRMTSVATAKGYTSDLNYDSE-PVPPPPTPRSQYLSAEENYESCPPSPYTERS 1596 >BC117136-1|AAI17137.1| 1613|Homo sapiens low density lipoprotein receptor-related protein 6 protein. Length = 1613 Score = 29.5 bits (63), Expect = 7.5 Identities = 16/56 (28%), Positives = 26/56 (46%) Frame = -3 Query: 252 APRTRVRKIVSLMHMTELLRSETRTPVPPIASPRGDYSSLRDRANSTPNNMTVEKT 85 AP R+ + + T L ++ PVPP +PR Y S + S P + E++ Sbjct: 1542 APSRRMTSVATAKGYTSDLNYDSE-PVPPPPTPRSQYLSAEENYESCPPSPYTERS 1596 >AF074264-1|AAC33006.1| 1613|Homo sapiens LDL receptor-related protein 6 protein. Length = 1613 Score = 29.5 bits (63), Expect = 7.5 Identities = 16/56 (28%), Positives = 26/56 (46%) Frame = -3 Query: 252 APRTRVRKIVSLMHMTELLRSETRTPVPPIASPRGDYSSLRDRANSTPNNMTVEKT 85 AP R+ + + T L ++ PVPP +PR Y S + S P + E++ Sbjct: 1542 APSRRMTSVATAKGYTSDLNYDSE-PVPPPPTPRSQYLSAEENYESCPPSPYTERS 1596 >AB209683-1|BAD92920.1| 1477|Homo sapiens low density lipoprotein receptor-related protein 6 variant protein. Length = 1477 Score = 29.5 bits (63), Expect = 7.5 Identities = 16/56 (28%), Positives = 26/56 (46%) Frame = -3 Query: 252 APRTRVRKIVSLMHMTELLRSETRTPVPPIASPRGDYSSLRDRANSTPNNMTVEKT 85 AP R+ + + T L ++ PVPP +PR Y S + S P + E++ Sbjct: 1406 APSRRMTSVATAKGYTSDLNYDSE-PVPPPPTPRSQYLSAEENYESCPPSPYTERS 1460 >AL832320-1|CAD38615.1| 465|Homo sapiens hypothetical protein protein. Length = 465 Score = 29.1 bits (62), Expect = 9.9 Identities = 15/28 (53%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = -2 Query: 499 SPIFPASII-QRRLHSSIATLNTEVSPP 419 SP+ PAS+ QRRL S LN +V+PP Sbjct: 328 SPVSPASVPGQRRLASRNGDLNLQVAPP 355 >AJ277365-1|CAC10539.1| 796|Homo sapiens polyglutamine-containing protein protein. Length = 796 Score = 29.1 bits (62), Expect = 9.9 Identities = 15/28 (53%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = -2 Query: 499 SPIFPASII-QRRLHSSIATLNTEVSPP 419 SP+ PAS+ QRRL S LN +V+PP Sbjct: 659 SPVSPASVPGQRRLASRNGDLNLQVAPP 686 >AB058768-1|BAB47494.1| 723|Homo sapiens KIAA1865 protein protein. Length = 723 Score = 29.1 bits (62), Expect = 9.9 Identities = 15/28 (53%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = -2 Query: 499 SPIFPASII-QRRLHSSIATLNTEVSPP 419 SP+ PAS+ QRRL S LN +V+PP Sbjct: 586 SPVSPASVPGQRRLASRNGDLNLQVAPP 613 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 82,056,392 Number of Sequences: 237096 Number of extensions: 1833826 Number of successful extensions: 3955 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 3833 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3955 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4990119376 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -