BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS311G10f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 23 2.5 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 22 4.4 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 21 7.7 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 22.6 bits (46), Expect = 2.5 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +3 Query: 264 SWPRVVRAGVSESGFGFVASSCVNAVYWRSV 356 +W GV+ G G VAS +A W+S+ Sbjct: 907 TWSNSQVQGVAVPGSGIVASGQQHAGGWQSI 937 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 21.8 bits (44), Expect = 4.4 Identities = 18/69 (26%), Positives = 27/69 (39%), Gaps = 1/69 (1%) Frame = -2 Query: 376 VEEKLRATDRQ*TAFTHELATKPNPLSDTPALTTRGHDTTSRLVLLQRKTN-SINMIDFT 200 + +K++ T L + + P +T GH + LL N SI +F Sbjct: 117 ISKKIKKTMENKDITKRPLPNESQLIKRHPIVTIMGHVDHGKTTLLDALRNTSIAKSEF- 175 Query: 199 GGRTSCESA 173 GG T C A Sbjct: 176 GGITQCIGA 184 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.0 bits (42), Expect = 7.7 Identities = 6/9 (66%), Positives = 8/9 (88%) Frame = +1 Query: 148 GRGRWYLPA 174 G G+WYLP+ Sbjct: 236 GDGKWYLPS 244 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,080 Number of Sequences: 438 Number of extensions: 3462 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -