BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS311G08f (521 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g32775.1 68418.m03902 hypothetical protein 28 3.3 At4g36150.1 68417.m05145 disease resistance protein (TIR-NBS-LRR... 28 4.4 >At5g32775.1 68418.m03902 hypothetical protein Length = 240 Score = 28.3 bits (60), Expect = 3.3 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = -2 Query: 115 AMFIDHSVLHKPKTKKRATLLKSRTLKR*HKSISLMS 5 A FI HS H K KKR L +R L R S ++++ Sbjct: 162 AFFIPHSTRHSSKRKKRRLQLFTRPLTRPRGSSTVLN 198 >At4g36150.1 68417.m05145 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1179 Score = 27.9 bits (59), Expect = 4.4 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -2 Query: 136 NRIGNTCAMFIDHSVLHKPKTKKRATLLKSRTLK 35 NR+G +F+D S L K R+T +K R L+ Sbjct: 544 NRVGAVRGIFLDMSELKKKLPLDRSTFIKMRNLR 577 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,140,830 Number of Sequences: 28952 Number of extensions: 225122 Number of successful extensions: 387 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 386 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 387 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 957410176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -