BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS311G07f (521 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g53050.2 68418.m06590 hydrolase, alpha/beta fold family prote... 27 5.8 At5g53050.1 68418.m06591 hydrolase, alpha/beta fold family prote... 27 5.8 >At5g53050.2 68418.m06590 hydrolase, alpha/beta fold family protein contains Pfam profile PF00561: hydrolase, alpha/beta fold family Length = 396 Score = 27.5 bits (58), Expect = 5.8 Identities = 13/43 (30%), Positives = 23/43 (53%), Gaps = 3/43 (6%) Frame = -2 Query: 421 LQAAEAVKILDYLGW---HVNFHYVGCSVARSRRHCVQSRVLA 302 + A +++ +LD+LGW H+ H +G +A RVL+ Sbjct: 105 IMANDSISLLDHLGWKKAHIIGHSMGAMIACKLAAMAPERVLS 147 >At5g53050.1 68418.m06591 hydrolase, alpha/beta fold family protein contains Pfam profile PF00561: hydrolase, alpha/beta fold family Length = 312 Score = 27.5 bits (58), Expect = 5.8 Identities = 13/43 (30%), Positives = 23/43 (53%), Gaps = 3/43 (6%) Frame = -2 Query: 421 LQAAEAVKILDYLGW---HVNFHYVGCSVARSRRHCVQSRVLA 302 + A +++ +LD+LGW H+ H +G +A RVL+ Sbjct: 105 IMANDSISLLDHLGWKKAHIIGHSMGAMIACKLAAMAPERVLS 147 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,662,817 Number of Sequences: 28952 Number of extensions: 242242 Number of successful extensions: 508 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 495 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 508 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 957410176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -