BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS311G05f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_05_0081 - 18924353-18924462,18925068-18925187,18925569-189260... 31 0.56 02_03_0360 + 18104948-18106159 29 3.0 01_06_1258 + 35806557-35806932,35807517-35807679,35807789-358078... 29 3.0 03_02_0446 - 8567436-8567567,8567649-8567768,8569837-8569914,857... 28 4.0 03_01_0303 + 2369607-2371958 27 6.9 >11_05_0081 - 18924353-18924462,18925068-18925187,18925569-18926086, 18927392-18927471,18927680-18927782,18928084-18928295, 18928392-18929210,18929331-18929444,18929935-18929983, 18930115-18930271,18930354-18930807,18930938-18931147 Length = 981 Score = 31.1 bits (67), Expect = 0.56 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = +3 Query: 366 LIAVAMLSTHYYFKYLGNDWTKKGGWKVLKTKPMVL 473 +I A+L H Y+ +L DW KK W L PM L Sbjct: 578 VIVYALLIVHGYYLFLTKDWYKKTTWMYLAV-PMFL 612 >02_03_0360 + 18104948-18106159 Length = 403 Score = 28.7 bits (61), Expect = 3.0 Identities = 16/38 (42%), Positives = 22/38 (57%) Frame = +3 Query: 126 SERERCLGMTDAERAWRKQWLKDQVLAAHEPVHVEEYW 239 SER + L DAER + L++Q+LA H V V + W Sbjct: 363 SERSKDLDEEDAERYEAIKNLREQMLAGHGFVLVSQEW 400 >01_06_1258 + 35806557-35806932,35807517-35807679,35807789-35807837, 35807943-35808866,35808954-35809049,35809142-35809257, 35809345-35809447,35809570-35809658,35809750-35809900, 35809995-35810141,35810238-35810366,35810451-35810529, 35810616-35810725 Length = 843 Score = 28.7 bits (61), Expect = 3.0 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +3 Query: 366 LIAVAMLSTHYYFKYLGNDWTKKGGWKVL 452 ++A +L H YF +L +W KK W L Sbjct: 481 VLAYVLLVVHSYFIFLTREWYKKTTWMYL 509 >03_02_0446 - 8567436-8567567,8567649-8567768,8569837-8569914, 8570018-8570122,8570214-8570306,8570464-8570619 Length = 227 Score = 28.3 bits (60), Expect = 4.0 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +1 Query: 310 QCWENNVLHIIDIYLENLV*SLWLCYQHIT 399 Q +E+N+ I+D + V S W+CY H+T Sbjct: 69 QSYEDNIKKIVDF---STVESFWVCYCHLT 95 >03_01_0303 + 2369607-2371958 Length = 783 Score = 27.5 bits (58), Expect = 6.9 Identities = 18/71 (25%), Positives = 27/71 (38%), Gaps = 2/71 (2%) Frame = +3 Query: 237 WRERTNPIRRFYRKPLDVLFAKLTPMLGEQRAAHYRYISGKLGLIAVAMLSTH--YYFKY 410 W P R +F L E+ AA R + G + A + H Y +++ Sbjct: 70 WEREKRPSSRLLYS-YHTVFDGFAVQLTEEEAAALRELPGVASVRADRRVELHTTYSYRF 128 Query: 411 LGNDWTKKGGW 443 LG D+ G W Sbjct: 129 LGLDFCPTGAW 139 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,842,779 Number of Sequences: 37544 Number of extensions: 314541 Number of successful extensions: 767 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 754 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 767 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -