BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS311G05f (521 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g09090.2 68414.m01015 respiratory burst oxidase protein B (Rb... 29 1.4 At1g09090.1 68414.m01014 respiratory burst oxidase protein B (Rb... 29 1.4 At5g51060.1 68418.m06329 respiratory burst oxidase protein C (Rb... 29 1.9 At1g32550.1 68414.m04017 ferredoxin family protein similar to fe... 29 2.5 At5g07690.1 68418.m00882 myb family transcription factor (MYB29)... 28 3.3 At4g25090.1 68417.m03604 respiratory burst oxidase, putative / N... 28 3.3 At1g71070.1 68414.m08202 glycosyltransferase family 14 protein /... 28 4.4 At3g47790.1 68416.m05206 ABC transporter family protein contains... 27 7.7 >At1g09090.2 68414.m01015 respiratory burst oxidase protein B (RbohB) / NADPH oxidase identical to respiratory burst oxidase protein B from Arabidopsis thaliana [gi:3242783] Length = 843 Score = 29.5 bits (63), Expect = 1.4 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = +3 Query: 345 YISGKLGLIAVAMLSTHYYFKYLGNDWTKKGGWKVLKTKPMVL 473 + S L +I +L H YF YL +W K W L P++L Sbjct: 481 WYSHHLFVIVYVLLIVHGYFVYLSKEWYHKTTWMYLAV-PVLL 522 >At1g09090.1 68414.m01014 respiratory burst oxidase protein B (RbohB) / NADPH oxidase identical to respiratory burst oxidase protein B from Arabidopsis thaliana [gi:3242783] Length = 622 Score = 29.5 bits (63), Expect = 1.4 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = +3 Query: 345 YISGKLGLIAVAMLSTHYYFKYLGNDWTKKGGWKVLKTKPMVL 473 + S L +I +L H YF YL +W K W L P++L Sbjct: 481 WYSHHLFVIVYVLLIVHGYFVYLSKEWYHKTTWMYLAV-PVLL 522 >At5g51060.1 68418.m06329 respiratory burst oxidase protein C (RbohC) / NADPH oxidase nearly identical to respiratory burst oxidase protein C from Arabidopsis thaliana [gi:3242785] Length = 905 Score = 29.1 bits (62), Expect = 1.9 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = +3 Query: 360 LGLIAVAMLSTHYYFKYLGNDWTKKGGWKVLKTKPMVL 473 L +I +L H Y+ YL DW K W L P+VL Sbjct: 540 LFVIVYILLVAHGYYLYLTRDWHNKTTWMYL-VVPVVL 576 >At1g32550.1 68414.m04017 ferredoxin family protein similar to ferredoxin from Synechocystis sp. [GI:48019]; contains Pfam profile PF00111 2Fe-2S iron-sulfur cluster binding domain Length = 181 Score = 28.7 bits (61), Expect = 2.5 Identities = 16/38 (42%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = -1 Query: 182 LLTPSPFCISHTKTSFPFT-GYATNYRHRFNTRCLCHF 72 L+ P FC S K +FP Y TN+R R T C F Sbjct: 3 LILPCTFCTSLQKKNFPINRRYITNFR-RGATTATCEF 39 >At5g07690.1 68418.m00882 myb family transcription factor (MYB29) similar to myb transcription factor GI:3941436 from [Arabidopsis thaliana] Length = 336 Score = 28.3 bits (60), Expect = 3.3 Identities = 11/42 (26%), Positives = 24/42 (57%) Frame = +1 Query: 241 ESVLILFVVFTGNPWTYSLRNLPQCWENNVLHIIDIYLENLV 366 E ++I+ GN W+ R+LP+ +N + + + +L+ L+ Sbjct: 75 EQIIIMLHASRGNKWSVIARHLPKRTDNEIKNYWNTHLKKLL 116 >At4g25090.1 68417.m03604 respiratory burst oxidase, putative / NADPH oxidase, putative similar to respiratory burst oxidase protein A from Arabidopsis thaliana, gb:AF055353 [gi:3242781], protein D [gi:3242789]; contains Pfam profile PF01794 Ferric reductase like transmembrane component Length = 849 Score = 28.3 bits (60), Expect = 3.3 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +3 Query: 360 LGLIAVAMLSTHYYFKYLGNDWTKKGGWKVL 452 L +I +L H Y+ YL +W KK W L Sbjct: 493 LFVIVYILLVLHGYYIYLNKEWYKKTTWMYL 523 >At1g71070.1 68414.m08202 glycosyltransferase family 14 protein / core-2/I-branching enzyme family protein similar to glucosaminyl (N-acetyl) transferase GB:4758422 from [Homo sapiens] Length = 395 Score = 27.9 bits (59), Expect = 4.4 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 4/54 (7%) Frame = +1 Query: 259 FVVFTGNPWTYSLRN-LPQC---WENNVLHIIDIYLENLV*SLWLCYQHITTLN 408 F VFTG+PW R L C W+ N+ I+ +Y N++ S CY H N Sbjct: 220 FKVFTGSPWIVLSRPFLEYCIFGWD-NLPRILLMYFNNVILS-EECYFHTVICN 271 >At3g47790.1 68416.m05206 ABC transporter family protein contains Pfam domain, PF00005: ABC transporter Length = 901 Score = 27.1 bits (57), Expect = 7.7 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -2 Query: 517 ESVFSDLNGNPGCPGRTIGLVFSTFQPPFF 428 ++ F+D++G GC +T GL +ST + F Sbjct: 53 DTQFNDVHGQCGCNEKTCGLRYSTSEQAAF 82 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,428,754 Number of Sequences: 28952 Number of extensions: 269100 Number of successful extensions: 733 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 710 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 733 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 957410176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -