BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS311G01f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. 22 3.8 DQ855504-1|ABH88191.1| 124|Tribolium castaneum chemosensory pro... 21 6.6 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 21 6.6 >DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. Length = 162 Score = 21.8 bits (44), Expect = 3.8 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +2 Query: 212 EPIASVVCSGRAAISTLLSGTQRPINYWRTNRS 310 +PI S C GR A +SG++ W+ RS Sbjct: 58 KPIPSFACIGRCASYIQVSGSK----IWQMERS 86 >DQ855504-1|ABH88191.1| 124|Tribolium castaneum chemosensory protein 18 protein. Length = 124 Score = 21.0 bits (42), Expect = 6.6 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -1 Query: 377 QYVVPDKSMLDDI 339 +YV+PD +DDI Sbjct: 19 EYVIPDNIDIDDI 31 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 21.0 bits (42), Expect = 6.6 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +1 Query: 238 REGCDLDPVIGDTEADKLLEDKPE 309 REG L+P+ TEAD P+ Sbjct: 386 REGKQLNPLNKGTEADSSFVTLPQ 409 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 127,030 Number of Sequences: 336 Number of extensions: 2861 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -