BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS311G01f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY735443-1|AAU08018.1| 163|Anopheles gambiae bursicon protein. 24 3.6 AY735442-1|AAU08017.1| 163|Anopheles gambiae bursicon protein. 24 3.6 AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcrip... 23 6.2 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 23 8.2 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 23 8.2 >AY735443-1|AAU08018.1| 163|Anopheles gambiae bursicon protein. Length = 163 Score = 23.8 bits (49), Expect = 3.6 Identities = 24/84 (28%), Positives = 36/84 (42%) Frame = +2 Query: 212 EPIASVVCSGRAAISTLLSGTQRPINYWRTNRSLNKLCE*KWLCRLASIYPAPRTASCPA 391 +PI S C GR A +SG++ W+ RS +C C+ + A + C Sbjct: 56 KPIPSFACIGRCASYIQVSGSK----IWQMERSC--MC-----CQESGEREASVSLFC-- 102 Query: 392 PPRASGGPLPWRLRNFSVRNPLSC 463 P+A G + R S + PL C Sbjct: 103 -PKAKNGEK--KFRKVSTKAPLEC 123 >AY735442-1|AAU08017.1| 163|Anopheles gambiae bursicon protein. Length = 163 Score = 23.8 bits (49), Expect = 3.6 Identities = 24/84 (28%), Positives = 36/84 (42%) Frame = +2 Query: 212 EPIASVVCSGRAAISTLLSGTQRPINYWRTNRSLNKLCE*KWLCRLASIYPAPRTASCPA 391 +PI S C GR A +SG++ W+ RS +C C+ + A + C Sbjct: 56 KPIPSFACIGRCASYIQVSGSK----IWQMERSC--MC-----CQESGEREASVSLFC-- 102 Query: 392 PPRASGGPLPWRLRNFSVRNPLSC 463 P+A G + R S + PL C Sbjct: 103 -PKAKNGEK--KFRKVSTKAPLEC 123 >AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcription factor protein. Length = 593 Score = 23.0 bits (47), Expect = 6.2 Identities = 12/37 (32%), Positives = 15/37 (40%) Frame = +3 Query: 396 PGHRAGHCRGGCETSRSEIRYPAPGT*QRSARHHRRP 506 P HR HC + + E PA GT + H P Sbjct: 407 PIHRIQHCTCMLQNNARESISPASGTGMSPSYPHSEP 443 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 22.6 bits (46), Expect = 8.2 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +1 Query: 388 GASQGIGRAIAVEVAKLLG 444 G +G+G A VEV K LG Sbjct: 2125 GEGRGVGEAEDVEVPKALG 2143 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 22.6 bits (46), Expect = 8.2 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 432 ETSRSEIRYPAPGT*QRSARHHRRP 506 ETS+ +I P Q+ RH +RP Sbjct: 2971 ETSKRDIPNIPPAPEQQPVRHQQRP 2995 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 584,195 Number of Sequences: 2352 Number of extensions: 12856 Number of successful extensions: 27 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -