BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS311F12f (397 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 0.96 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 3.9 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 3.9 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 6.8 AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 20 9.0 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 23.4 bits (48), Expect = 0.96 Identities = 10/36 (27%), Positives = 15/36 (41%) Frame = +1 Query: 16 FFCLDAKFRFDDXAEFRQKELFSLRDTTQEDPKEIE 123 +FCLD K DD + S + E P ++ Sbjct: 428 YFCLDGKLPHDDQPPLSPQSDSSSSSRSAESPMSVQ 463 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.4 bits (43), Expect = 3.9 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +1 Query: 139 LNYIALDGNIGCMVNGAGLAMATMDIIKL 225 L I LDGN +NG ++A++ ++ L Sbjct: 528 LEAIRLDGNFLSDINGVFTSIASLLLLNL 556 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.4 bits (43), Expect = 3.9 Identities = 10/38 (26%), Positives = 18/38 (47%) Frame = +1 Query: 106 DPKEIEAAKYNLNYIALDGNIGCMVNGAGLAMATMDII 219 D + A+ L+Y+ L G + C + L + DI+ Sbjct: 683 DTPVVRASGRELSYVLLSGILLCYLVTFALVLRPTDIV 720 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 20.6 bits (41), Expect = 6.8 Identities = 9/34 (26%), Positives = 17/34 (50%) Frame = -3 Query: 332 IAVTFGSERMILNASETAWXVAPPPTSKKLAGSP 231 +A +GS+ I+N+S P ++ + SP Sbjct: 561 VATMYGSDEEIINSSNDEGGKTSPNSAVRKCMSP 594 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 20.2 bits (40), Expect = 9.0 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = +3 Query: 189 WISYGYDGY 215 W S+ YDGY Sbjct: 149 WASWTYDGY 157 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 99,697 Number of Sequences: 438 Number of extensions: 2234 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 9761793 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -