BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS311F07f (521 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI000065FF00 Cluster: Homolog of Homo sapiens "PREDICT... 33 4.0 UniRef50_Q6CM62 Cluster: Similar to sp|P47104 Saccharomyces cere... 32 6.9 >UniRef50_UPI000065FF00 Cluster: Homolog of Homo sapiens "PREDICTED "SHC (Src homology 2 domain containing) transforming protein 2; n=1; Takifugu rubripes|Rep: Homolog of Homo sapiens "PREDICTED "SHC (Src homology 2 domain containing) transforming protein 2 - Takifugu rubripes Length = 154 Score = 33.1 bits (72), Expect = 4.0 Identities = 21/59 (35%), Positives = 29/59 (49%), Gaps = 2/59 (3%) Frame = +1 Query: 331 IFYVKVTKS*EICLLSVLVK-CKHVLIFADLL*KRWHSIVLFVKV-LC*QTRTLRYVIC 501 +F V V+ C+ SVLV+ C H +F+ L+ WH+ V V V C T L C Sbjct: 11 VFSVLVSTCWHTCVFSVLVRTCWHTCVFSVLVSTSWHTCVFSVLVSTCWHTCYLLQAAC 69 >UniRef50_Q6CM62 Cluster: Similar to sp|P47104 Saccharomyces cerevisiae YJR033c RAV1 singleton; n=1; Kluyveromyces lactis|Rep: Similar to sp|P47104 Saccharomyces cerevisiae YJR033c RAV1 singleton - Kluyveromyces lactis (Yeast) (Candida sphaerica) Length = 1363 Score = 32.3 bits (70), Expect = 6.9 Identities = 19/44 (43%), Positives = 24/44 (54%) Frame = +3 Query: 9 FIRNESTIIKVGNVTFGQLLVNQKNELLTLYSIGSHKILLNDIL 140 +++N S II GN F + + T SIGS KIL NDIL Sbjct: 702 WLKNGSIIIATGNQVFIKDKSLDLKDKFTYSSIGSRKILSNDIL 745 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 445,972,424 Number of Sequences: 1657284 Number of extensions: 7827363 Number of successful extensions: 14550 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14197 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14548 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 32619212418 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -