BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS311F07f (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC16A11.12c |ubp1||ubiquitin C-terminal hydrolase Ubp1|Schizos... 25 6.8 SPCC645.13 |||transcription elongation regulator|Schizosaccharom... 25 9.0 >SPCC16A11.12c |ubp1||ubiquitin C-terminal hydrolase Ubp1|Schizosaccharomyces pombe|chr 3|||Manual Length = 849 Score = 25.0 bits (52), Expect = 6.8 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = -1 Query: 485 SVLVC*HNTFTKSTIECHLFYNKSAKISTCLHFTRTL 375 S++V KST+EC + Y KS ++ T L Sbjct: 426 SIIVQLFQGMYKSTLECSICYQKSTAFDPFMYLTLPL 462 >SPCC645.13 |||transcription elongation regulator|Schizosaccharomyces pombe|chr 3|||Manual Length = 721 Score = 24.6 bits (51), Expect = 9.0 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +3 Query: 327 IHILCESNEELGDMPPQCSG 386 + +C+S E++GD QC G Sbjct: 21 VRCVCKSQEDIGDTWVQCDG 40 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,982,920 Number of Sequences: 5004 Number of extensions: 36331 Number of successful extensions: 77 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 76 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 77 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -