BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS311F07f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY823259-1|AAX18444.1| 194|Anopheles gambiae pburs protein. 24 3.6 DQ370036-1|ABD18597.1| 103|Anopheles gambiae putative TIL domai... 23 6.2 >AY823259-1|AAX18444.1| 194|Anopheles gambiae pburs protein. Length = 194 Score = 23.8 bits (49), Expect = 3.6 Identities = 12/43 (27%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = +3 Query: 327 IHILCESNEELGDMPPQCSGE--MQACAYLCGFIVKKMALNCT 449 IH++ E +ELG + C+G+ + C C V+ + T Sbjct: 92 IHLIKEEYDELGRLYRTCNGDVTVNKCEGKCNSQVQPSVITAT 134 >DQ370036-1|ABD18597.1| 103|Anopheles gambiae putative TIL domain protein protein. Length = 103 Score = 23.0 bits (47), Expect = 6.2 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = -2 Query: 256 GNLCIWTKKC 227 G CIW KKC Sbjct: 84 GGSCIWAKKC 93 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 490,345 Number of Sequences: 2352 Number of extensions: 8770 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -