BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS311F07f (521 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g22560.1 68417.m03256 expressed protein 28 4.4 At4g21270.1 68417.m03074 kinesin-like protein A (KATA) 27 5.8 >At4g22560.1 68417.m03256 expressed protein Length = 264 Score = 27.9 bits (59), Expect = 4.4 Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = -3 Query: 141 LRCRSEEFCD-YQWNTKSIIRFSDLPIIVQKSHC 43 L+C+S+ F D Y +N+KS++ S + SHC Sbjct: 9 LQCKSKAFDDVYNFNSKSLMSSSSYNCSRKSSHC 42 >At4g21270.1 68417.m03074 kinesin-like protein A (KATA) Length = 793 Score = 27.5 bits (58), Expect = 5.8 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = +3 Query: 315 FVDPIHILCESNEELGDMPPQ-CSGEM 392 F + H+LCE + L DM Q C GE+ Sbjct: 390 FEEQKHLLCELQDRLADMEHQLCEGEL 416 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,820,537 Number of Sequences: 28952 Number of extensions: 173481 Number of successful extensions: 312 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 308 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 312 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 957410176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -