BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS311F06f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory recept... 21 5.0 AM292332-1|CAL23144.2| 344|Tribolium castaneum gustatory recept... 21 5.0 AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory recept... 21 8.7 >AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory receptor candidate 55 protein. Length = 402 Score = 21.4 bits (43), Expect = 5.0 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +1 Query: 142 ERHESKDFVASKHL*YY*LTVEIFLFRFKSKKNNYDVID 258 ++H+S F S ++ Y L LFR + +NN VI+ Sbjct: 49 KQHKSDYFYFSFYITSYTLLSVYSLFRIATNENNSLVIN 87 >AM292332-1|CAL23144.2| 344|Tribolium castaneum gustatory receptor candidate 11 protein. Length = 344 Score = 21.4 bits (43), Expect = 5.0 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +1 Query: 142 ERHESKDFVASKHL*YY*LTVEIFLFRFKSKKNNYDVID 258 ++H+S F S ++ Y L LFR + +NN VI+ Sbjct: 49 KQHKSDYFYFSFYITSYTLLSVYSLFRIATNENNSLVIN 87 >AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory receptor candidate 9 protein. Length = 408 Score = 20.6 bits (41), Expect = 8.7 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -3 Query: 459 DYNQFRHLCVL 427 DYN+ HLC L Sbjct: 270 DYNRLCHLCFL 280 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 99,803 Number of Sequences: 336 Number of extensions: 1736 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -