BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS311E08f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_1202 + 10389090-10389140,10389218-10389853,10390355-103904... 29 2.3 07_01_0449 - 3392512-3393504 28 5.2 03_06_0313 + 33073542-33074464,33074901-33075069 27 6.9 02_01_0399 - 2905026-2905406,2905522-2905630,2905809-2907475,290... 27 9.1 >06_01_1202 + 10389090-10389140,10389218-10389853,10390355-10390439, 10390536-10390654,10391251-10391318,10391401-10391710 Length = 422 Score = 29.1 bits (62), Expect = 2.3 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = -2 Query: 118 SKLVVLLEPSVPGFWGHCSPHLGCRLRHIAQACRPNL 8 ++L V+L P + GF G C P+L H R L Sbjct: 132 TRLFVVLHPCIQGFLGGCRPYLAIDSTHFTGKYRGQL 168 >07_01_0449 - 3392512-3393504 Length = 330 Score = 27.9 bits (59), Expect = 5.2 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 262 RQQVQFYENHGDICITTSRVPSCQSHC 342 R V FY + G CI + P+CQ++C Sbjct: 68 RLPVFFYYHGGGFCIGSRTWPNCQNYC 94 >03_06_0313 + 33073542-33074464,33074901-33075069 Length = 363 Score = 27.5 bits (58), Expect = 6.9 Identities = 31/114 (27%), Positives = 44/114 (38%), Gaps = 7/114 (6%) Frame = +2 Query: 128 ISTQASYALTQLGKKNHSPPV----RINGSLKPSISLEATTNTRA--LVKLGNRCSFMRT 289 +S + +A +LGK+ SPPV ++ L + S A +N R T Sbjct: 44 LSNRVGHARARLGKRRSSPPVDPGCLMDHPLAAAASSPAPSNGRLHFSSSAATASPSPAT 103 Query: 290 TAISVSQLRECPR-VSRIAVLETTKYSTFK*RVNRNSTTTSACTKNRSKRARTP 448 A + S P V R LETT + + +A KN SK A P Sbjct: 104 AAAASSAANVTPAVVDRSLFLETTLLDLNSRGAPAPAASMAAAAKNSSKLAPAP 157 >02_01_0399 - 2905026-2905406,2905522-2905630,2905809-2907475, 2907650-2907790,2907870-2908043,2908577-2908851, 2909592-2909755,2910409-2910536,2910628-2910734, 2911747-2911880,2912266-2912441,2912530-2914257, 2915084-2915239,2915328-2915486,2915581-2915751, 2915931-2916047,2916417-2916473,2916565-2916680, 2916790-2916916,2917862-2917945 Length = 2056 Score = 27.1 bits (57), Expect = 9.1 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +1 Query: 151 SDPTWQEESQSSGEDQWQSETVYKSRSYD 237 SD W S G+D W S +SR+ D Sbjct: 1792 SDSAWNAAPVSQGDDVWNSAEANESRNKD 1820 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.316 0.130 0.396 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,828,142 Number of Sequences: 37544 Number of extensions: 309247 Number of successful extensions: 836 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 815 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 836 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -