BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS311E08f (521 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC017227-1|AAH17227.1| 301|Homo sapiens phosducin-like protein. 29 7.5 AL359512-2|CAI94958.1| 301|Homo sapiens phosducin-like protein. 29 7.5 AF031463-1|AAD01930.1| 301|Homo sapiens phosducin-like protein ... 29 7.5 AK124415-1|BAC85848.1| 809|Homo sapiens protein ( Homo sapiens ... 29 9.9 AB055660-1|BAB84689.1| 1995|Homo sapiens Shroom-related protein ... 29 9.9 AB040914-1|BAA96005.1| 1380|Homo sapiens KIAA1481 protein protein. 29 9.9 >BC017227-1|AAH17227.1| 301|Homo sapiens phosducin-like protein. Length = 301 Score = 29.5 bits (63), Expect = 7.5 Identities = 14/52 (26%), Positives = 30/52 (57%) Frame = +1 Query: 331 QSHCRAGDYKIQHVQVTCKSKLDHDFRMYKEQIKKGQNPEVSGIPSVKQFKV 486 + CR + I+ + +TC+S LD + ++Q +K ++SG ++K+F + Sbjct: 78 EEQCREMERLIKKLSMTCRSHLDEE---EEQQKQKDLQEKISGKMTLKEFAI 126 >AL359512-2|CAI94958.1| 301|Homo sapiens phosducin-like protein. Length = 301 Score = 29.5 bits (63), Expect = 7.5 Identities = 14/52 (26%), Positives = 30/52 (57%) Frame = +1 Query: 331 QSHCRAGDYKIQHVQVTCKSKLDHDFRMYKEQIKKGQNPEVSGIPSVKQFKV 486 + CR + I+ + +TC+S LD + ++Q +K ++SG ++K+F + Sbjct: 78 EEQCREMERLIKKLSMTCRSHLDEE---EEQQKQKDLQEKISGKMTLKEFAI 126 >AF031463-1|AAD01930.1| 301|Homo sapiens phosducin-like protein protein. Length = 301 Score = 29.5 bits (63), Expect = 7.5 Identities = 14/52 (26%), Positives = 30/52 (57%) Frame = +1 Query: 331 QSHCRAGDYKIQHVQVTCKSKLDHDFRMYKEQIKKGQNPEVSGIPSVKQFKV 486 + CR + I+ + +TC+S LD + ++Q +K ++SG ++K+F + Sbjct: 78 EEQCREMERLIKKLSMTCRSHLDEE---EEQQKQKDLQEKISGKMTLKEFAI 126 >AK124415-1|BAC85848.1| 809|Homo sapiens protein ( Homo sapiens cDNA FLJ42424 fis, clone BLADE2004089, moderately similar to Mus musculus PDZ domain actin binding protein Shroom ). Length = 809 Score = 29.1 bits (62), Expect = 9.9 Identities = 15/51 (29%), Positives = 24/51 (47%) Frame = +1 Query: 52 LNEENSDPKTQELKALATQQAYYPEYKYTSILRSDPTWQEESQSSGEDQWQ 204 L E + P Q+L A+ P+ +LRS T+Q S+ E +W+ Sbjct: 366 LEEASRQPCGQQLSGGASDSGRGPQRPDARLLRSQSTFQLSSEPEREPEWR 416 >AB055660-1|BAB84689.1| 1995|Homo sapiens Shroom-related protein protein. Length = 1995 Score = 29.1 bits (62), Expect = 9.9 Identities = 15/51 (29%), Positives = 24/51 (47%) Frame = +1 Query: 52 LNEENSDPKTQELKALATQQAYYPEYKYTSILRSDPTWQEESQSSGEDQWQ 204 L E + P Q+L A+ P+ +LRS T+Q S+ E +W+ Sbjct: 854 LEEASRQPCGQQLSGGASDSGRGPQRPDARLLRSQSTFQLSSEPEREPEWR 904 >AB040914-1|BAA96005.1| 1380|Homo sapiens KIAA1481 protein protein. Length = 1380 Score = 29.1 bits (62), Expect = 9.9 Identities = 15/51 (29%), Positives = 24/51 (47%) Frame = +1 Query: 52 LNEENSDPKTQELKALATQQAYYPEYKYTSILRSDPTWQEESQSSGEDQWQ 204 L E + P Q+L A+ P+ +LRS T+Q S+ E +W+ Sbjct: 239 LEEASRQPCGQQLSGGASDSGRGPQRPDARLLRSQSTFQLSSEPEREPEWR 289 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.316 0.130 0.396 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 79,449,211 Number of Sequences: 237096 Number of extensions: 1656531 Number of successful extensions: 4952 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 4815 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4952 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4990119376 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -