BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS311E08f (521 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g46720.1 68416.m05072 UDP-glucoronosyl/UDP-glucosyl transfera... 31 0.62 At3g46700.1 68416.m05070 UDP-glucoronosyl/UDP-glucosyl transfera... 29 1.9 At5g52200.1 68418.m06479 expressed protein 29 2.5 At5g38260.1 68418.m04612 serine/threonine protein kinase, putati... 29 2.5 At1g63010.2 68414.m07116 SPX (SYG1/Pho81/XPR1) domain-containing... 29 2.5 At1g63010.1 68414.m07115 SPX (SYG1/Pho81/XPR1) domain-containing... 29 2.5 At3g46690.1 68416.m05068 UDP-glucoronosyl/UDP-glucosyl transfera... 28 4.4 At3g46680.1 68416.m05067 UDP-glucoronosyl/UDP-glucosyl transfera... 28 4.4 At3g44630.3 68416.m04798 disease resistance protein RPP1-WsB-lik... 27 5.8 At3g44630.2 68416.m04800 disease resistance protein RPP1-WsB-lik... 27 5.8 At3g44630.1 68416.m04799 disease resistance protein RPP1-WsB-lik... 27 5.8 At1g37050.1 68414.m04624 hypothetical protein 27 5.8 At5g59590.1 68418.m07467 UDP-glucoronosyl/UDP-glucosyl transfera... 27 7.7 At5g59580.1 68418.m07466 UDP-glucoronosyl/UDP-glucosyl transfera... 27 7.7 At4g02510.1 68417.m00343 chloroplast outer membrane protein, put... 27 7.7 At3g07460.2 68416.m00889 expressed protein contains Pfam profile... 27 7.7 >At3g46720.1 68416.m05072 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 447 Score = 30.7 bits (66), Expect = 0.62 Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 2/54 (3%) Frame = -2 Query: 169 LAKLGQSVGCLCTYILGSKLVVLLEPSVPGFWGHC--SPHLGCRLRHIAQACRP 14 ++K+ GC+ + ++ VL+ P+V GFW HC + L + + CRP Sbjct: 310 VSKIVSERGCIVKWAPQNE--VLVHPAVGGFWSHCGWNSTLESIVEGVPMICRP 361 >At3g46700.1 68416.m05070 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 385 Score = 29.1 bits (62), Expect = 1.9 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = -2 Query: 115 KLVVLLEPSVPGFWGHC--SPHLGCRLRHIAQACRP 14 ++ VL PSV GFW HC + L + + CRP Sbjct: 268 QIEVLGHPSVGGFWSHCGWNSTLESIVEGVPMICRP 303 >At5g52200.1 68418.m06479 expressed protein Length = 191 Score = 28.7 bits (61), Expect = 2.5 Identities = 22/72 (30%), Positives = 35/72 (48%), Gaps = 2/72 (2%) Frame = +1 Query: 19 DKPELYAAAYSLNEENSDPKTQELKALATQQAYYPEYKYTSILRSDPTW--QEESQSSGE 192 D+ E A +EE S E + A ++A+Y E++ LRS ++ +EE + G Sbjct: 94 DEEEEEADPMDQDEEGSGSGKNE-RFNAHRKAHYDEFRKVKELRSSGSFYEEEEEEDDGA 152 Query: 193 DQWQSETVYKSR 228 +SET SR Sbjct: 153 KGSKSETTTNSR 164 >At5g38260.1 68418.m04612 serine/threonine protein kinase, putative similar to receptor serine/threonine kinase PR55K gi|1235680|gb|AAC49208; contains protein kinase domain, Pfam:PF00069; contains serine/threonine protein kinase domain, INTERPRO:IPR002290 Length = 638 Score = 28.7 bits (61), Expect = 2.5 Identities = 11/39 (28%), Positives = 22/39 (56%) Frame = +1 Query: 82 QELKALATQQAYYPEYKYTSILRSDPTWQEESQSSGEDQ 198 +E A + AY+P++ Y ++ + TW+ + S ED+ Sbjct: 525 EETAASNSSSAYFPDWIYKNLENGEDTWKFGDEISREDK 563 >At1g63010.2 68414.m07116 SPX (SYG1/Pho81/XPR1) domain-containing protein contains Pfam profile PF03105: SPX domain Length = 699 Score = 28.7 bits (61), Expect = 2.5 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = -3 Query: 255 TSALVFVVASRLIDGFRLPLILTGGL 178 TSA V +SR+ +G RLPL++T G+ Sbjct: 450 TSATDRVESSRVEEGLRLPLLITSGI 475 >At1g63010.1 68414.m07115 SPX (SYG1/Pho81/XPR1) domain-containing protein contains Pfam profile PF03105: SPX domain Length = 699 Score = 28.7 bits (61), Expect = 2.5 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = -3 Query: 255 TSALVFVVASRLIDGFRLPLILTGGL 178 TSA V +SR+ +G RLPL++T G+ Sbjct: 450 TSATDRVESSRVEEGLRLPLLITSGI 475 >At3g46690.1 68416.m05068 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 452 Score = 27.9 bits (59), Expect = 4.4 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = -2 Query: 115 KLVVLLEPSVPGFWGHC--SPHLGCRLRHIAQACRP 14 ++ VL P+V GFW HC + L + + CRP Sbjct: 335 QIEVLGHPAVGGFWSHCGWNSTLESIVEGVPMICRP 370 >At3g46680.1 68416.m05067 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 449 Score = 27.9 bits (59), Expect = 4.4 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = -2 Query: 115 KLVVLLEPSVPGFWGHC--SPHLGCRLRHIAQACRP 14 ++ VL P+V GFW HC + L + + CRP Sbjct: 335 QIEVLGHPAVGGFWSHCGWNSTLESIVEGVPMICRP 370 >At3g44630.3 68416.m04798 disease resistance protein RPP1-WsB-like (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein., closest Col-0 homolog to RPP1-WsB Length = 1240 Score = 27.5 bits (58), Expect = 5.8 Identities = 18/48 (37%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = +2 Query: 176 HSPPVR-INGSLKPSISLEATTNTRALVKLGNRCSFMRTTAISVSQLR 316 HSP +R + +I L +T N LV+L RCS +R QLR Sbjct: 692 HSPRIRSLKWFPYQNICLPSTFNPEFLVELDMRCSKLRKLWEGTKQLR 739 >At3g44630.2 68416.m04800 disease resistance protein RPP1-WsB-like (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein., closest Col-0 homolog to RPP1-WsB Length = 1214 Score = 27.5 bits (58), Expect = 5.8 Identities = 18/48 (37%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = +2 Query: 176 HSPPVR-INGSLKPSISLEATTNTRALVKLGNRCSFMRTTAISVSQLR 316 HSP +R + +I L +T N LV+L RCS +R QLR Sbjct: 692 HSPRIRSLKWFPYQNICLPSTFNPEFLVELDMRCSKLRKLWEGTKQLR 739 >At3g44630.1 68416.m04799 disease resistance protein RPP1-WsB-like (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein., closest Col-0 homolog to RPP1-WsB Length = 1214 Score = 27.5 bits (58), Expect = 5.8 Identities = 18/48 (37%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = +2 Query: 176 HSPPVR-INGSLKPSISLEATTNTRALVKLGNRCSFMRTTAISVSQLR 316 HSP +R + +I L +T N LV+L RCS +R QLR Sbjct: 692 HSPRIRSLKWFPYQNICLPSTFNPEFLVELDMRCSKLRKLWEGTKQLR 739 >At1g37050.1 68414.m04624 hypothetical protein Length = 620 Score = 27.5 bits (58), Expect = 5.8 Identities = 11/22 (50%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = -1 Query: 326 EGTLEVVIQ-ISPWFS*NCTCC 264 EG L+VVI+ + PW C CC Sbjct: 218 EGELDVVIKYLYPWLPPRCNCC 239 >At5g59590.1 68418.m07467 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 449 Score = 27.1 bits (57), Expect = 7.7 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -2 Query: 115 KLVVLLEPSVPGFWGHC 65 ++ VL P+V GFW HC Sbjct: 335 QMEVLRHPAVGGFWSHC 351 >At5g59580.1 68418.m07466 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 453 Score = 27.1 bits (57), Expect = 7.7 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -2 Query: 115 KLVVLLEPSVPGFWGHC 65 ++ VL P+V GFW HC Sbjct: 333 QIEVLRHPAVGGFWSHC 349 >At4g02510.1 68417.m00343 chloroplast outer membrane protein, putative similar to chloroplast protein import component Toc159 [Pisum sativum] GI:8489806, chloroplast outer envelope protein 86 [Pisum sativum] GI:599958, GTP-binding protein [Pisum sativum] GI:576509 Length = 1503 Score = 27.1 bits (57), Expect = 7.7 Identities = 21/66 (31%), Positives = 28/66 (42%), Gaps = 7/66 (10%) Frame = +1 Query: 76 KTQELKALATQQ-AYYPEYKYTSILRSDPTWQE------ESQSSGEDQWQSETVYKSRSY 234 KTQ K Q+ AY+ EY Y L W+E E + +G+ +SE Y Sbjct: 1156 KTQLAKLSNEQRKAYFEEYDYRVKLLQKKQWREELKRMKEMKKNGKKLGESEFGYPGEED 1215 Query: 235 DKHKGA 252 D GA Sbjct: 1216 DPENGA 1221 >At3g07460.2 68416.m00889 expressed protein contains Pfam profile PF04398: Protein of unknown function, DUF538 Length = 271 Score = 27.1 bits (57), Expect = 7.7 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = +1 Query: 217 YKSRSYDKHKGACEVRQQVQFYENHGDICITTSRVPSCQSHCRAG 351 Y ++ + VR +F + D+ I +SR S + HC AG Sbjct: 132 YSLSLFETPRDCVAVRGDAEFIGSVFDVAIVSSRSNSWKKHCLAG 176 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.316 0.130 0.396 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,775,703 Number of Sequences: 28952 Number of extensions: 244953 Number of successful extensions: 807 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 785 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 807 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 957410176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -