BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS311E04f (422 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-5|CAD27756.1| 245|Anopheles gambiae putative deoxynucl... 24 2.0 AF488801-1|AAO49462.1| 246|Anopheles gambiae multisubstrate deo... 24 2.0 AY045760-2|AAK84943.1| 169|Anopheles gambiae D7-related 3 prote... 23 4.6 AJ133854-1|CAB39729.1| 169|Anopheles gambiae D7-related 3 prote... 23 4.6 EF989011-1|ABS17666.1| 399|Anopheles gambiae serpin 7 protein. 23 6.0 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 6.0 AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript... 23 6.0 >AJ439060-5|CAD27756.1| 245|Anopheles gambiae putative deoxynucleoside kinase protein. Length = 245 Score = 24.2 bits (50), Expect = 2.0 Identities = 13/53 (24%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Frame = +2 Query: 200 SMNVMSLRSC-VKRAASLMTAALCSTARNMDLSTLGGRFRLRSSMYNLINTFY 355 ++ ++ + +C ++ LM +L S ARN + ++ L MYN++ +Y Sbjct: 80 TLTMLDMHTCQTDKSVKLMERSLFS-ARNCFVESMLASGSLHQGMYNVLQEWY 131 >AF488801-1|AAO49462.1| 246|Anopheles gambiae multisubstrate deoxyribonucleoside kinaseprotein. Length = 246 Score = 24.2 bits (50), Expect = 2.0 Identities = 13/53 (24%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Frame = +2 Query: 200 SMNVMSLRSC-VKRAASLMTAALCSTARNMDLSTLGGRFRLRSSMYNLINTFY 355 ++ ++ + +C ++ LM +L S ARN + ++ L MYN++ +Y Sbjct: 80 TLTMLDMHTCQTDKSVKLMERSLFS-ARNCFVESMLASGSLHQGMYNVLQEWY 131 >AY045760-2|AAK84943.1| 169|Anopheles gambiae D7-related 3 protein protein. Length = 169 Score = 23.0 bits (47), Expect = 4.6 Identities = 8/14 (57%), Positives = 13/14 (92%) Frame = -3 Query: 177 YVDLLTSGELELGT 136 YV+LL +G+L++GT Sbjct: 136 YVELLRAGKLDMGT 149 >AJ133854-1|CAB39729.1| 169|Anopheles gambiae D7-related 3 protein protein. Length = 169 Score = 23.0 bits (47), Expect = 4.6 Identities = 8/14 (57%), Positives = 13/14 (92%) Frame = -3 Query: 177 YVDLLTSGELELGT 136 YV+LL +G+L++GT Sbjct: 136 YVELLRAGKLDMGT 149 >EF989011-1|ABS17666.1| 399|Anopheles gambiae serpin 7 protein. Length = 399 Score = 22.6 bits (46), Expect = 6.0 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = -3 Query: 153 ELELGTAQSLDDLCLPPVTRAHGHD 79 ELE A + DL LP T HD Sbjct: 283 ELETSVAPKMVDLWLPKFTIEDSHD 307 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 22.6 bits (46), Expect = 6.0 Identities = 11/42 (26%), Positives = 20/42 (47%) Frame = +2 Query: 212 MSLRSCVKRAASLMTAALCSTARNMDLSTLGGRFRLRSSMYN 337 M L++C +M L S + + +++L FR +YN Sbjct: 2391 MILKACTNLKEEMMKQKLFSESADAPVASLSEGFRKALQIYN 2432 >AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase protein. Length = 1154 Score = 22.6 bits (46), Expect = 6.0 Identities = 11/58 (18%), Positives = 25/58 (43%), Gaps = 3/58 (5%) Frame = +2 Query: 233 KRAASLMTAALCSTARNMDLSTLGGRFRLR---SSMYNLINTFYSXXXXXXNSRGGPV 397 KR ++ +C+ ++ R + S++ N+I +++ N+ GPV Sbjct: 575 KRCLMVVALDICNAFNTASWQSIADALRNKGVPSALLNIIGSYFEERKLIYNTSAGPV 632 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 473,511 Number of Sequences: 2352 Number of extensions: 8686 Number of successful extensions: 17 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 35060166 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -