BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS311E04f (422 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 23 1.1 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 4.3 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 20 10.0 AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 20 10.0 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 23.4 bits (48), Expect = 1.1 Identities = 8/30 (26%), Positives = 18/30 (60%) Frame = +2 Query: 200 SMNVMSLRSCVKRAASLMTAALCSTARNMD 289 ++N+++ C K ++M A+C+ A+ D Sbjct: 314 TLNMLTQVECYKYYGNIMVNAMCAYAKGKD 343 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.4 bits (43), Expect = 4.3 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = -3 Query: 345 LIRLYIEDLSLNLPPSVERSMFR 277 LIRL + +LS N+ ++ MF+ Sbjct: 334 LIRLIVLNLSYNMLTHIDARMFK 356 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 20.2 bits (40), Expect = 10.0 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +1 Query: 256 GCIVQYRPEHGPLDAWRKVQAEI 324 G I Y PE GP +K + EI Sbjct: 197 GAIGAYGPEKGPKVPEKKKEDEI 219 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 20.2 bits (40), Expect = 10.0 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = -1 Query: 101 SLERTDMMGCPMRTRATVP*G 39 SLER D GC +P G Sbjct: 572 SLERFDFCGCGWPQHMLIPKG 592 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 124,135 Number of Sequences: 438 Number of extensions: 2168 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10873896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -