BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS311D07f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41667| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.44 SB_8388| Best HMM Match : ig (HMM E-Value=8.80001e-41) 31 0.76 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 29 1.8 SB_27592| Best HMM Match : 7tm_1 (HMM E-Value=3.8e-39) 29 1.8 SB_9407| Best HMM Match : DCX (HMM E-Value=2.6) 28 5.4 SB_11586| Best HMM Match : CLN3 (HMM E-Value=8.3e-10) 27 7.1 SB_58714| Best HMM Match : Linker_histone (HMM E-Value=5.7e-15) 27 9.4 SB_54958| Best HMM Match : NUDE_C (HMM E-Value=9.8) 27 9.4 SB_38454| Best HMM Match : DCX (HMM E-Value=4.2) 27 9.4 SB_1495| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_402| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 >SB_41667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 605 Score = 31.5 bits (68), Expect = 0.44 Identities = 19/79 (24%), Positives = 31/79 (39%) Frame = +2 Query: 101 FDLATMSLFDIFGDHLTRQAVKNVSRQPLHNIENMGKVVSAGPTKPNEPTKKGETKKSFL 280 F T+S + + D++ A R+P H I + + PT+ KK K Sbjct: 438 FPAGTVSRWRVIADYVNDHAKTGNKREPKHVIVKVKSLKKIDPTQIENVNKKAFAKFDLS 497 Query: 281 SNTGKAIQSTPSRKVFTPR 337 GKA + + + PR Sbjct: 498 HTQGKASEESVPTVRYEPR 516 >SB_8388| Best HMM Match : ig (HMM E-Value=8.80001e-41) Length = 666 Score = 30.7 bits (66), Expect = 0.76 Identities = 11/27 (40%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = +3 Query: 264 PRNLFY-QILGKQFRAHHHVKCSPLVL 341 PR LFY +++G+ R H +CSP + Sbjct: 257 PRGLFYIRVIGRDLRGHEFYRCSPTAI 283 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 29.5 bits (63), Expect = 1.8 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = +2 Query: 65 DDIEKISLSKLTFDLATMSLFDIFGDHLTRQAVKNVSRQ-PLHNIENM 205 D+I K+ L TF A LFD G H A ++RQ P+H +E + Sbjct: 207 DEIGKMELFSQTFSRAIQDLFD--GGHSPILATVPIARQKPIHLVEQL 252 >SB_27592| Best HMM Match : 7tm_1 (HMM E-Value=3.8e-39) Length = 340 Score = 29.5 bits (63), Expect = 1.8 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +2 Query: 347 VGSLIYTDEDGDKGCTFEEIEFTKPKHYDN 436 V L Y D KG +E ++FTK HY N Sbjct: 253 VNVLFYYDPKRGKGVPYELVQFTKLLHYSN 282 >SB_9407| Best HMM Match : DCX (HMM E-Value=2.6) Length = 306 Score = 27.9 bits (59), Expect = 5.4 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +2 Query: 311 PSRKVFTPRAVNVGSLIYTDEDGDK 385 PSR++ + AV VGS++Y D DK Sbjct: 75 PSRRLTSEPAVRVGSIVYLSCDKDK 99 >SB_11586| Best HMM Match : CLN3 (HMM E-Value=8.3e-10) Length = 507 Score = 27.5 bits (58), Expect = 7.1 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +2 Query: 74 EKISLSKLTFDLATMSLFDIFGDHLTRQAV 163 EK+ SK LA L +F D+ T QAV Sbjct: 69 EKVQASKCNMHLAVPLLIGLFADYATMQAV 98 >SB_58714| Best HMM Match : Linker_histone (HMM E-Value=5.7e-15) Length = 169 Score = 27.1 bits (57), Expect = 9.4 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 218 SAGPTKPNEPTKKGETKKSFLSNTGKAIQSTPSRK 322 S T PN+ TK GET K+ T K ++ +K Sbjct: 107 SVKKTAPNDKTKAGETPKAAGKKTAKPAKAKRGKK 141 >SB_54958| Best HMM Match : NUDE_C (HMM E-Value=9.8) Length = 267 Score = 27.1 bits (57), Expect = 9.4 Identities = 18/53 (33%), Positives = 26/53 (49%) Frame = +2 Query: 362 YTDEDGDKGCTFEEIEFTKPKHYDNYQRDLFDFIPLSEPCHLKQLSPPSTPPP 520 Y D+D D+ + + KP+ Q + DF LS+P H + P TPPP Sbjct: 204 YDDDDDDE----DNMVVVKPRG----QVEHIDF-GLSKPMHYSNVRPRGTPPP 247 >SB_38454| Best HMM Match : DCX (HMM E-Value=4.2) Length = 239 Score = 27.1 bits (57), Expect = 9.4 Identities = 14/43 (32%), Positives = 19/43 (44%) Frame = +2 Query: 194 IENMGKVVSAGPTKPNEPTKKGETKKSFLSNTGKAIQSTPSRK 322 + N K V+AGP K PTK K+ T + + RK Sbjct: 45 LNNSAKYVAAGPEKSRVPTKTHFKAKNLSKTTPNRTKPSHGRK 87 >SB_1495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 461 Score = 27.1 bits (57), Expect = 9.4 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = +2 Query: 260 ETKKSFLSNTGKAIQSTPSRKVFTPRAVNVGSLIYTDEDGDKGCTFE 400 E +K+ + G+A T R V TP +V V ++ +DE D T E Sbjct: 160 EARKAIRKSWGRA--DTSKRNVTTPESVRVIFVVGSDEKSDSRVTKE 204 >SB_402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 730 Score = 27.1 bits (57), Expect = 9.4 Identities = 15/45 (33%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +2 Query: 122 LFDIFGDHLTRQA-VKNVSRQPLHNIENMGKVVSAGPTKPNEPTK 253 ++++F L R A +K V + P + + G++VSA P PTK Sbjct: 78 IWEVFNGTLPRPASLKTVGKIPKSLLVHYGELVSANPRIRPNPTK 122 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,581,548 Number of Sequences: 59808 Number of extensions: 303413 Number of successful extensions: 862 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 768 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 859 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -