BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS311D05f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 22 3.8 AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory recept... 21 6.6 AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory recept... 21 6.6 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 21.8 bits (44), Expect = 3.8 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -2 Query: 70 IILKC*YLIHVYVFTFTYSYLN 5 II+ C + VF+F Y Y N Sbjct: 257 IIIGCLIQFNTIVFSFCYCYYN 278 >AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory receptor candidate 60 protein. Length = 364 Score = 21.0 bits (42), Expect = 6.6 Identities = 8/34 (23%), Positives = 16/34 (47%) Frame = -1 Query: 104 YVFILKSQCNTHNS*MLIFNTCVRIYFYLFLLKH 3 Y+ + +Q + + + CV + F L+ L H Sbjct: 237 YIILTNNQAKYCTTLIGLIKNCVIVIFELYYLSH 270 >AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory receptor candidate 50 protein. Length = 350 Score = 21.0 bits (42), Expect = 6.6 Identities = 8/37 (21%), Positives = 16/37 (43%) Frame = -2 Query: 202 VHQENCTLESIRCNTFETTPLIIILLKFQPCLLMYLF 92 VH E C L + + + + +L F C+ + + Sbjct: 217 VHNELCNLCQVANSIYGFQNFLFVLSTFSICITQFYY 253 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 132,462 Number of Sequences: 336 Number of extensions: 3032 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -