BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS311D05f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_38268| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_42286| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_21169| Best HMM Match : zf-CHY (HMM E-Value=2.1e-09) 27 7.1 SB_19755| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 >SB_38268| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1071 Score = 37.9 bits (84), Expect = 0.005 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +1 Query: 403 WGEGTFLAIQTAMIAALVLHYGGAPMKGGIFLSVYCAIV 519 WGE FL IQT+++ L H+ PM +F +Y V Sbjct: 928 WGESFFLCIQTSLLIILYFHFNRKPMIAALFCGLYAVSV 966 >SB_42286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1820 Score = 30.3 bits (65), Expect = 1.0 Identities = 12/50 (24%), Positives = 27/50 (54%) Frame = +1 Query: 313 GINIYGVYLELFAITANFAYSYVMGFPFSAWGEGTFLAIQTAMIAALVLH 462 G+ Y +YL++ + A + +++ AWG + TA +AA++++ Sbjct: 1533 GVEGYNLYLQIVQVMATYRRRFMLKAVVFAWGVPAVIVAITATVAAVLVN 1582 >SB_21169| Best HMM Match : zf-CHY (HMM E-Value=2.1e-09) Length = 2059 Score = 27.5 bits (58), Expect = 7.1 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +2 Query: 239 SASF*GPYW*KCHKFSKFYKVRVPKESIFME 331 S + G +W + HK YKV+ KE I +E Sbjct: 71 SVLYRGNFWLELHKIRHAYKVKKNKEGIVLE 101 >SB_19755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 621 Score = 27.1 bits (57), Expect = 9.4 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = -1 Query: 305 LLLCKILKICGTFTSMDPRMMPIPRPLLSVDLKHGTSRKL 186 L+L K LKI D +P+P LL +D GT+ ++ Sbjct: 344 LILTKDLKIKKVDVYTDANSIPLPTHLLRIDQDDGTTLRI 383 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,018,118 Number of Sequences: 59808 Number of extensions: 330924 Number of successful extensions: 528 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 500 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 528 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -