BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS311D05f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. 25 1.5 DQ974167-1|ABJ52807.1| 434|Anopheles gambiae serpin 8 protein. 24 3.6 AY193728-1|AAO62001.1| 519|Anopheles gambiae cytochrome P450 CY... 24 3.6 AF364131-1|AAL35507.1| 378|Anopheles gambiae putative odorant r... 23 4.7 >AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. Length = 1132 Score = 25.0 bits (52), Expect = 1.5 Identities = 7/24 (29%), Positives = 17/24 (70%) Frame = +3 Query: 198 CTMFQIHTQQRSRNRHHSRVHTGK 269 C+++Q+ Q+R+ + HH + +G+ Sbjct: 243 CSLYQVDPQRRAPHSHHLVIKSGE 266 >DQ974167-1|ABJ52807.1| 434|Anopheles gambiae serpin 8 protein. Length = 434 Score = 23.8 bits (49), Expect = 3.6 Identities = 11/44 (25%), Positives = 19/44 (43%) Frame = +1 Query: 274 PQIFKILQSKSAEGINIYGVYLELFAITANFAYSYVMGFPFSAW 405 P + ++ +S + Y EL N + ++ PFSAW Sbjct: 45 PGVDRLQRSSQKFALQFYQYVTELVDYNPNVTTTNIIVSPFSAW 88 >AY193728-1|AAO62001.1| 519|Anopheles gambiae cytochrome P450 CYPm3r5 protein. Length = 519 Score = 23.8 bits (49), Expect = 3.6 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -1 Query: 182 FRKYSL*HF*DNTPNNNPFKISAMFTY 102 FR+ HF +TP N+P K+ M T+ Sbjct: 212 FRRIGRKHF--DTPRNHPLKVFIMKTF 236 >AF364131-1|AAL35507.1| 378|Anopheles gambiae putative odorant receptor Or2 protein. Length = 378 Score = 23.4 bits (48), Expect = 4.7 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 319 NIYGVYLELFAITANFAYSY 378 N+Y + LE+F N +YSY Sbjct: 350 NVYPMTLEMFQKLLNVSYSY 369 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 566,455 Number of Sequences: 2352 Number of extensions: 11573 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -