BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS311D03f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 24 0.94 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 5.0 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 23.8 bits (49), Expect = 0.94 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = -2 Query: 154 RNIVVFVLRLLDATKCIQIELSKLLYPRCRVALT 53 RNI+V L ++ T C++I+++ + RV L+ Sbjct: 739 RNIIVGTLMMVLGTGCVRIKITGVWLKFLRVILS 772 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.4 bits (43), Expect = 5.0 Identities = 7/22 (31%), Positives = 10/22 (45%) Frame = +3 Query: 423 GLVDECCLKPCYTYDLLNYCWN 488 GL+ C C+ + CWN Sbjct: 1105 GLITFGCSNRCFFPSKIRICWN 1126 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 113,705 Number of Sequences: 336 Number of extensions: 2347 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -