BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS311D03f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21009| Best HMM Match : Insulin (HMM E-Value=7.5e-06) 31 0.76 SB_18415| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_10135| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 28 5.4 SB_33125| Best HMM Match : Pkinase (HMM E-Value=0) 27 7.1 SB_34539| Best HMM Match : SIR2 (HMM E-Value=1.7) 27 9.4 SB_19731| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 >SB_21009| Best HMM Match : Insulin (HMM E-Value=7.5e-06) Length = 122 Score = 30.7 bits (66), Expect = 0.76 Identities = 20/84 (23%), Positives = 37/84 (44%), Gaps = 3/84 (3%) Frame = +3 Query: 240 CGRHLANARMILCYD---TVEKRAQSYLDANIISSGDLSSWPGLSSQYAKTRAFALAEKS 410 CG +++A I+CY T +R + D +I+ S D + +Q K + Sbjct: 48 CGDQISDAWTIICYGGGVTARQRQINRRDLSIVQSADEARQFNSKTQRGKRSSIYT---- 103 Query: 411 KRGPGLVDECCLKPCYTYDLLNYC 482 + +ECC++ C ++ YC Sbjct: 104 -----ITEECCVEGCKQEEIREYC 122 >SB_18415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 623 Score = 27.9 bits (59), Expect = 5.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 156 LYFLIVVALVSADVHDKELKIEENPRVYCGR 248 L F+IV V KE+++E+ P YCGR Sbjct: 7 LLFIIVTLSAVHQVLGKEVELEKCPGQYCGR 37 >SB_10135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 27.9 bits (59), Expect = 5.4 Identities = 12/22 (54%), Positives = 14/22 (63%), Gaps = 4/22 (18%) Frame = +3 Query: 429 VDECC----LKPCYTYDLLNYC 482 +D CC L PCYTY LL+ C Sbjct: 162 LDSCCTYRFLDPCYTYRLLDPC 183 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 27.9 bits (59), Expect = 5.4 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = -3 Query: 258 WPNDVRNRPEDFPQFSTLCRGRQHSPAPQRSGNTA 154 W N RP FS+L + ++ +P PQ +TA Sbjct: 51 WRNASERRPSGRGFFSSLFKKKKQAPTPQTQASTA 85 >SB_33125| Best HMM Match : Pkinase (HMM E-Value=0) Length = 937 Score = 27.5 bits (58), Expect = 7.1 Identities = 18/46 (39%), Positives = 21/46 (45%) Frame = +3 Query: 210 LKIEENPRVYCGRHLANARMILCYDTVEKRAQSYLDANIISSGDLS 347 L E P V C R + RM LC T + SY +I S DLS Sbjct: 757 LSNENEPYVVCHRFICQCRMSLCCVTTCHMSVSY----VIVSSDLS 798 >SB_34539| Best HMM Match : SIR2 (HMM E-Value=1.7) Length = 1384 Score = 27.1 bits (57), Expect = 9.4 Identities = 15/52 (28%), Positives = 23/52 (44%) Frame = -1 Query: 290 DSVIAEYHACVGQMTSAIDPRIFLNFQLFVVDVSTHQRHNDQEIQQKHRGIR 135 + V + C Q+ P N LF + + Q+ ND+EIQ +G R Sbjct: 287 EMVFSSLSECATQVPERCSPGELPNETLFRLLIEEMQQLNDREIQLSEQGCR 338 >SB_19731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 665 Score = 27.1 bits (57), Expect = 9.4 Identities = 19/64 (29%), Positives = 25/64 (39%) Frame = +1 Query: 220 RKILGSIADVIWPTHA*YSAMTLSRREPNLISTQTLFRREI*APGLACLPSTPRLALLLS 399 R+I + + W Y LS LFR E+ G + P PRL L + Sbjct: 332 REIRAKLFRLFWLRTIAYHPEFLSSASHTNTQGIILFRAELSILGASYFPYLPRLQRLTT 391 Query: 400 PKNL 411 P NL Sbjct: 392 PNNL 395 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,639,117 Number of Sequences: 59808 Number of extensions: 314272 Number of successful extensions: 805 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 764 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 805 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -