BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS311D03f (521 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g04810.1 68416.m00520 protein kinase, putative similar to LST... 28 4.4 At1g44760.1 68414.m05128 universal stress protein (USP) family p... 27 5.8 At1g14780.1 68414.m01767 expressed protein 27 5.8 At3g50000.1 68416.m05467 casein kinase II alpha chain 2 identica... 27 7.7 At3g12280.1 68416.m01533 retinoblastoma-related protein (RBR1) n... 27 7.7 At3g10440.1 68416.m01252 hypothetical protein 27 7.7 At1g31720.1 68414.m03892 expressed protein 27 7.7 >At3g04810.1 68416.m00520 protein kinase, putative similar to LSTK-1-like kinase [Lycopersicon esculentum] GI:15637110; contains Pfam profile: PF00069 Eukaryotic protein kinase domain Length = 606 Score = 27.9 bits (59), Expect = 4.4 Identities = 17/55 (30%), Positives = 20/55 (36%) Frame = -3 Query: 309 KIGLSSRQCHSRVSCVRWPNDVRNRPEDFPQFSTLCRGRQHSPAPQRSGNTAETS 145 KI L S V +WP R FP+ G+ HS P R E S Sbjct: 264 KIHLKVNDPGSNVLPAQWPESESARRNSFPEQRRRPAGKSHSFGPSRFRGNLEDS 318 >At1g44760.1 68414.m05128 universal stress protein (USP) family protein contains Pfam profile PF00582: universal stress protein family Length = 213 Score = 27.5 bits (58), Expect = 5.8 Identities = 15/48 (31%), Positives = 22/48 (45%) Frame = +3 Query: 366 SQYAKTRAFALAEKSKRGPGLVDECCLKPCYTYDLLNYCWNNSVCLTV 509 SQ K L K+ L+ C P + +L+N C N + CLT+ Sbjct: 141 SQVKKLEVSVLVLGQKKSAPLIS-CLCGPSRSEELVNRCINGADCLTI 187 >At1g14780.1 68414.m01767 expressed protein Length = 627 Score = 27.5 bits (58), Expect = 5.8 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -3 Query: 255 PNDVRNRPEDFPQFSTLCRGRQHSP 181 P N+ F S LCRG QHSP Sbjct: 568 PVPANNKIVKFVDLSQLCRGPQHSP 592 >At3g50000.1 68416.m05467 casein kinase II alpha chain 2 identical to casein kinase II, alpha chain 2 (CK II) [Arabidopsis thaliana] SWISS-PROT:Q08466 Length = 403 Score = 27.1 bits (57), Expect = 7.7 Identities = 13/45 (28%), Positives = 22/45 (48%) Frame = +3 Query: 285 TVEKRAQSYLDANIISSGDLSSWPGLSSQYAKTRAFALAEKSKRG 419 TV +A+ Y D N+I D + L+ Q+ + + + K RG Sbjct: 69 TVMSKARVYTDVNVIRPKDYWDYESLNVQWGEQDDYEVVRKVGRG 113 >At3g12280.1 68416.m01533 retinoblastoma-related protein (RBR1) nearly identical to retinoblastoma-related protein [Arabidopsis thaliana] GI:8777927; contains Pfam profiles: PF01858 retinoblastoma-associated protein A domain, PF01857 retinoblastoma-associated protein B domain Length = 1013 Score = 27.1 bits (57), Expect = 7.7 Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 4/39 (10%) Frame = -1 Query: 344 QISRRNNVCVEIRLGSLLDSVIAE----YHACVGQMTSA 240 ++S +NV V GS +D++I+ Y+ACVG+ T A Sbjct: 901 KVSAVHNVYVSPLRGSKMDALISHSTKSYYACVGESTHA 939 >At3g10440.1 68416.m01252 hypothetical protein Length = 556 Score = 27.1 bits (57), Expect = 7.7 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = -3 Query: 252 NDVRNRPEDFPQFSTLCRGRQHSPAPQRSGNTAET 148 ND N D Q C GRQ S + R + ET Sbjct: 235 NDAENHINDNVQSKRYCAGRQSSSSKTREASQTET 269 >At1g31720.1 68414.m03892 expressed protein Length = 194 Score = 27.1 bits (57), Expect = 7.7 Identities = 14/46 (30%), Positives = 20/46 (43%) Frame = +3 Query: 261 ARMILCYDTVEKRAQSYLDANIISSGDLSSWPGLSSQYAKTRAFAL 398 A LC ++A++ L A + G W G S + RAF L Sbjct: 28 AAFFLCLSAEFQKAKALLRAQVFLKGKDLKWDGESCYLPENRAFGL 73 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,820,754 Number of Sequences: 28952 Number of extensions: 214918 Number of successful extensions: 579 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 570 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 579 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 957410176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -