BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS311D02f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46749| Best HMM Match : No HMM Matches (HMM E-Value=.) 225 1e-59 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 7e-08 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 7e-08 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 54 7e-08 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 7e-08 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 54 7e-08 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 7e-08 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 7e-08 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 54 7e-08 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 7e-08 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 7e-08 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 54 7e-08 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 7e-08 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 54 7e-08 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 52 2e-07 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 2e-07 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 47 1e-05 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 46 1e-05 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 44 6e-05 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_53825| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 5e-04 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 38 0.005 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.020 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.047 SB_4878| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.76 SB_17008| Best HMM Match : Galactosyl_T (HMM E-Value=3.6e-30) 29 1.8 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_6110| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_7597| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_2549| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_30413| Best HMM Match : WSC (HMM E-Value=2.4) 28 5.4 SB_59116| Best HMM Match : TPR_1 (HMM E-Value=6.7e-15) 28 5.4 SB_10994| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_45792| Best HMM Match : RVT_1 (HMM E-Value=3.5e-26) 27 7.1 SB_3438| Best HMM Match : RVT_1 (HMM E-Value=1.3e-30) 27 7.1 SB_36211| Best HMM Match : RVT_1 (HMM E-Value=0) 27 9.4 SB_34026| Best HMM Match : PLDc (HMM E-Value=0.063) 27 9.4 SB_34456| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 >SB_46749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 225 bits (551), Expect = 1e-59 Identities = 105/120 (87%), Positives = 115/120 (95%) Frame = -3 Query: 444 LEEKDPKRLFEGNALLRRLVRIGVLDEKQMKLDYVLGLKIEDFLERRLQTQVFKAGLAKS 265 LEEKDP+RLFEGNALLRRLVRIGVLDE + KLDYVLGL+IEDFLERRLQTQVFK GLAKS Sbjct: 60 LEEKDPRRLFEGNALLRRLVRIGVLDESRKKLDYVLGLRIEDFLERRLQTQVFKLGLAKS 119 Query: 264 IHHARILIRQRHIRVRKQVVNIPSFIVRLDSGKHIDFSLKSPFGGGRPGRVKRKNLRKGQ 85 IHHAR+LIRQRHIRVRKQ+VN+PSF+VRLDS KHIDFSL SP+GGGRPGRVKRKN++KGQ Sbjct: 120 IHHARVLIRQRHIRVRKQLVNVPSFVVRLDSQKHIDFSLNSPYGGGRPGRVKRKNMKKGQ 179 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 54.0 bits (124), Expect = 7e-08 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 521 SHDVVKRRPVNCNTTHYRANW 459 SHDVVKRRPVNCNTTHYRANW Sbjct: 4 SHDVVKRRPVNCNTTHYRANW 24 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 54.0 bits (124), Expect = 7e-08 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 521 SHDVVKRRPVNCNTTHYRANW 459 SHDVVKRRPVNCNTTHYRANW Sbjct: 60 SHDVVKRRPVNCNTTHYRANW 80 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 54.0 bits (124), Expect = 7e-08 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 521 SHDVVKRRPVNCNTTHYRANW 459 SHDVVKRRPVNCNTTHYRANW Sbjct: 628 SHDVVKRRPVNCNTTHYRANW 648 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 54.0 bits (124), Expect = 7e-08 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 521 SHDVVKRRPVNCNTTHYRANW 459 SHDVVKRRPVNCNTTHYRANW Sbjct: 39 SHDVVKRRPVNCNTTHYRANW 59 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 54.0 bits (124), Expect = 7e-08 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 521 SHDVVKRRPVNCNTTHYRANW 459 SHDVVKRRPVNCNTTHYRANW Sbjct: 41 SHDVVKRRPVNCNTTHYRANW 61 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 54.0 bits (124), Expect = 7e-08 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 521 SHDVVKRRPVNCNTTHYRANW 459 SHDVVKRRPVNCNTTHYRANW Sbjct: 1879 SHDVVKRRPVNCNTTHYRANW 1899 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 54.0 bits (124), Expect = 7e-08 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 521 SHDVVKRRPVNCNTTHYRANW 459 SHDVVKRRPVNCNTTHYRANW Sbjct: 39 SHDVVKRRPVNCNTTHYRANW 59 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 54.0 bits (124), Expect = 7e-08 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 521 SHDVVKRRPVNCNTTHYRANW 459 SHDVVKRRPVNCNTTHYRANW Sbjct: 33 SHDVVKRRPVNCNTTHYRANW 53 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 54.0 bits (124), Expect = 7e-08 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 521 SHDVVKRRPVNCNTTHYRANW 459 SHDVVKRRPVNCNTTHYRANW Sbjct: 82 SHDVVKRRPVNCNTTHYRANW 102 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 54.0 bits (124), Expect = 7e-08 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 521 SHDVVKRRPVNCNTTHYRANW 459 SHDVVKRRPVNCNTTHYRANW Sbjct: 60 SHDVVKRRPVNCNTTHYRANW 80 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 54.0 bits (124), Expect = 7e-08 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 521 SHDVVKRRPVNCNTTHYRANW 459 SHDVVKRRPVNCNTTHYRANW Sbjct: 71 SHDVVKRRPVNCNTTHYRANW 91 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 54.0 bits (124), Expect = 7e-08 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 521 SHDVVKRRPVNCNTTHYRANW 459 SHDVVKRRPVNCNTTHYRANW Sbjct: 47 SHDVVKRRPVNCNTTHYRANW 67 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 54.0 bits (124), Expect = 7e-08 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 521 SHDVVKRRPVNCNTTHYRANW 459 SHDVVKRRPVNCNTTHYRANW Sbjct: 71 SHDVVKRRPVNCNTTHYRANW 91 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 52.4 bits (120), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 518 HDVVKRRPVNCNTTHYRANW 459 HDVVKRRPVNCNTTHYRANW Sbjct: 2 HDVVKRRPVNCNTTHYRANW 21 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 52.4 bits (120), Expect = 2e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 518 HDVVKRRPVNCNTTHYRANW 459 HDVVKRRPVNCNTTHYRANW Sbjct: 2 HDVVKRRPVNCNTTHYRANW 21 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 49.6 bits (113), Expect = 2e-06 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -1 Query: 521 SHDVVKRRPVNCNTTHYRAN 462 SHDVVKRRPVNCNTTHYRAN Sbjct: 21 SHDVVKRRPVNCNTTHYRAN 40 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 46.8 bits (106), Expect = 1e-05 Identities = 22/26 (84%), Positives = 22/26 (84%) Frame = +3 Query: 444 GGARYPIRPIVSRITIHWPSFYNVVT 521 GGA PIRPIVS ITIHWPSFYN VT Sbjct: 38 GGA--PIRPIVSHITIHWPSFYNGVT 61 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 46.4 bits (105), Expect = 1e-05 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = +3 Query: 444 GGARYPIRPIVSRITIHWPSFYNVVT 521 GGA PIRPIVSRITIHWP+FYN T Sbjct: 36 GGA--PIRPIVSRITIHWPAFYNAPT 59 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 44.4 bits (100), Expect = 6e-05 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -1 Query: 521 SHDVVKRRPVNCNTTHYRAN 462 SHD KRRPVNCNTTHYRAN Sbjct: 78 SHDGEKRRPVNCNTTHYRAN 97 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 43.2 bits (97), Expect = 1e-04 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = +3 Query: 462 IRPIVSRITIHWPSFYNVVT 521 +RP+VSRITIHW SFYNVVT Sbjct: 33 LRPVVSRITIHWTSFYNVVT 52 >SB_53825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 41.5 bits (93), Expect = 4e-04 Identities = 25/87 (28%), Positives = 43/87 (49%) Frame = -3 Query: 444 LEEKDPKRLFEGNALLRRLVRIGVLDEKQMKLDYVLGLKIEDFLERRLQTQVFKAGLAKS 265 L+ KDP R+ +L +L +G++ K+ L + F RRL + +A+ Sbjct: 64 LDPKDPYRVEATEQILEKLHNMGLISTKK-NLGQCNKVNASSFCRRRLPVVMVNLKMAQV 122 Query: 264 IHHARILIRQRHIRVRKQVVNIPSFIV 184 + A I Q H+RV +V+ P+F+V Sbjct: 123 VKDAVKYIEQGHVRVGPEVIMDPAFLV 149 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 41.1 bits (92), Expect = 5e-04 Identities = 19/30 (63%), Positives = 21/30 (70%) Frame = +3 Query: 432 PSPRGGARYPIRPIVSRITIHWPSFYNVVT 521 P PR + P +SRITIHWPSFYNVVT Sbjct: 68 PPPRWSSN---SPYMSRITIHWPSFYNVVT 94 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 39.9 bits (89), Expect = 0.001 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +3 Query: 462 IRPIVSRITIHWPSFY 509 IRPIVSRITIHWPSFY Sbjct: 18 IRPIVSRITIHWPSFY 33 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 37.9 bits (84), Expect = 0.005 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +3 Query: 477 SRITIHWPSFYNVVT 521 SRITIHWPSFYNVVT Sbjct: 2 SRITIHWPSFYNVVT 16 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 37.9 bits (84), Expect = 0.005 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +3 Query: 477 SRITIHWPSFYNVVT 521 SRITIHWPSFYNVVT Sbjct: 2 SRITIHWPSFYNVVT 16 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 37.9 bits (84), Expect = 0.005 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +3 Query: 477 SRITIHWPSFYNVVT 521 SRITIHWPSFYNVVT Sbjct: 2 SRITIHWPSFYNVVT 16 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 37.9 bits (84), Expect = 0.005 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +3 Query: 477 SRITIHWPSFYNVVT 521 SRITIHWPSFYNVVT Sbjct: 2 SRITIHWPSFYNVVT 16 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 37.9 bits (84), Expect = 0.005 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +3 Query: 477 SRITIHWPSFYNVVT 521 SRITIHWPSFYNVVT Sbjct: 2 SRITIHWPSFYNVVT 16 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 37.9 bits (84), Expect = 0.005 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +3 Query: 477 SRITIHWPSFYNVVT 521 SRITIHWPSFYNVVT Sbjct: 2 SRITIHWPSFYNVVT 16 >SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 37.9 bits (84), Expect = 0.005 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +3 Query: 477 SRITIHWPSFYNVVT 521 SRITIHWPSFYNVVT Sbjct: 2 SRITIHWPSFYNVVT 16 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 37.9 bits (84), Expect = 0.005 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +3 Query: 477 SRITIHWPSFYNVVT 521 SRITIHWPSFYNVVT Sbjct: 2 SRITIHWPSFYNVVT 16 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 37.9 bits (84), Expect = 0.005 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +3 Query: 477 SRITIHWPSFYNVVT 521 SRITIHWPSFYNVVT Sbjct: 2 SRITIHWPSFYNVVT 16 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 37.9 bits (84), Expect = 0.005 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +3 Query: 477 SRITIHWPSFYNVVT 521 SRITIHWPSFYNVVT Sbjct: 2 SRITIHWPSFYNVVT 16 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 37.9 bits (84), Expect = 0.005 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +3 Query: 477 SRITIHWPSFYNVVT 521 SRITIHWPSFYNVVT Sbjct: 2 SRITIHWPSFYNVVT 16 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 35.9 bits (79), Expect = 0.020 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +3 Query: 477 SRITIHWPSFYNVV 518 SRITIHWPSFYNVV Sbjct: 2 SRITIHWPSFYNVV 15 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 34.7 bits (76), Expect = 0.047 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = +3 Query: 477 SRITIHWPSFYNVV 518 SRITIHWPSFYNV+ Sbjct: 2 SRITIHWPSFYNVM 15 >SB_4878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 598 Score = 30.7 bits (66), Expect = 0.76 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -1 Query: 515 DVVKRRPVNCNTTHYRANWVPGPPSRRRTPRDCSK 411 +V+K+ P+ + +R +PGPP R P+ SK Sbjct: 495 EVMKKIPIKRRSVPHRHRGIPGPPDNLRPPKKKSK 529 >SB_17008| Best HMM Match : Galactosyl_T (HMM E-Value=3.6e-30) Length = 508 Score = 29.5 bits (63), Expect = 1.8 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = -1 Query: 521 SHDVVKRRPVNCNTTHYRANWVPGPPSRRRTPRDCSKVMPFY 396 SHDVVKRRPV + H + + PP TP D + +Y Sbjct: 411 SHDVVKRRPV--PSLHACRSTLEDPPIDTTTPIDTTTRYRYY 450 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 29.1 bits (62), Expect = 2.3 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +3 Query: 492 HWPSFYNVVT 521 HWPSFYNVVT Sbjct: 5 HWPSFYNVVT 14 >SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 29.1 bits (62), Expect = 2.3 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +3 Query: 492 HWPSFYNVVT 521 HWPSFYNVVT Sbjct: 62 HWPSFYNVVT 71 >SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 29.1 bits (62), Expect = 2.3 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +3 Query: 492 HWPSFYNVVT 521 HWPSFYNVVT Sbjct: 5 HWPSFYNVVT 14 >SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 29.1 bits (62), Expect = 2.3 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +3 Query: 492 HWPSFYNVVT 521 HWPSFYNVVT Sbjct: 57 HWPSFYNVVT 66 >SB_6110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2051 Score = 28.7 bits (61), Expect = 3.1 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 6/38 (15%) Frame = -1 Query: 512 VVKRRPVNCNTTHYRANWVPG--PPSRRR----TPRDC 417 + +R PV+ H R+NWVP P S +R TP +C Sbjct: 367 LARRTPVSVLCEHLRSNWVPNEYPASMKRLFEWTPDEC 404 >SB_7597| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 208 Score = 28.3 bits (60), Expect = 4.1 Identities = 21/71 (29%), Positives = 32/71 (45%) Frame = +3 Query: 252 WHDGWTSPGQL*TPASADDAPRSPQSSDQAHNRVSSVFHPVLQYEPDDVEGHYLRTISWG 431 W D T+P + A D+ P + S N V++ P+ VE H+ + + Sbjct: 103 WEDQSTAPVESGLAAPWDEQPSAYTGSHPVENTVAA---PLEDQSAAPVESHH-QAYRYR 158 Query: 432 PSPRGGARYPI 464 PRGGARY + Sbjct: 159 -RPRGGARYQL 168 >SB_2549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1155 Score = 28.3 bits (60), Expect = 4.1 Identities = 21/84 (25%), Positives = 37/84 (44%), Gaps = 1/84 (1%) Frame = -3 Query: 348 DYVLGLKIEDFLERRLQTQVFKAGLAKSIHHARILIRQRHIRVRKQVVNI-PSFIVRLDS 172 D + G++ D+ L K +A L QR + V K VV F+++ + Sbjct: 128 DTLRGVQKHDYARLNLDAPALKNPIALPFMRRHQLTPQRIMGVVKTVVQSNEQFVLQGNF 187 Query: 171 GKHIDFSLKSPFGGGRPGRVKRKN 100 H+ P+GGG+ G+ K+ + Sbjct: 188 HLHV-VRTHMPYGGGKRGKSKKNS 210 >SB_30413| Best HMM Match : WSC (HMM E-Value=2.4) Length = 259 Score = 27.9 bits (59), Expect = 5.4 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +3 Query: 201 CSQLACGHEYAFAGSKFWHDGWTSP 275 C++LA Y++ G +FW + W+ P Sbjct: 72 CARLAEQKNYSYFGVQFWGECWSGP 96 >SB_59116| Best HMM Match : TPR_1 (HMM E-Value=6.7e-15) Length = 884 Score = 27.9 bits (59), Expect = 5.4 Identities = 15/49 (30%), Positives = 27/49 (55%) Frame = -3 Query: 390 LVRIGVLDEKQMKLDYVLGLKIEDFLERRLQTQVFKAGLAKSIHHARIL 244 L++I D+K M+ +Y+LGL +E +R +++ + K H R L Sbjct: 806 LLQILTQDDKNMEAEYLLGLILERQGKRLEAMKLYMDVIRKDTSHVRAL 854 >SB_10994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 27.5 bits (58), Expect = 7.1 Identities = 12/22 (54%), Positives = 15/22 (68%), Gaps = 2/22 (9%) Frame = -1 Query: 470 RANWVPGPPSRR--RTPRDCSK 411 R++W P PPSRR RTP S+ Sbjct: 6 RSDWTPAPPSRRSDRTPAPPSR 27 >SB_45792| Best HMM Match : RVT_1 (HMM E-Value=3.5e-26) Length = 600 Score = 27.5 bits (58), Expect = 7.1 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +1 Query: 199 DVHNLLADTNMPLPDQNSGMMDGLRQASFEHLRLQTTLQEVLN 327 D+ + A MP P +G+ D + Q +FE +++ T VL+ Sbjct: 381 DLEKVKAICEMPQPVDIAGVQDLIAQEAFEKIKMMITKAPVLH 423 >SB_3438| Best HMM Match : RVT_1 (HMM E-Value=1.3e-30) Length = 1405 Score = 27.5 bits (58), Expect = 7.1 Identities = 17/63 (26%), Positives = 34/63 (53%) Frame = -3 Query: 417 FEGNALLRRLVRIGVLDEKQMKLDYVLGLKIEDFLERRLQTQVFKAGLAKSIHHARILIR 238 F G A+ + G+L + LD ++G K ED+ +RRL+ ++ K A++ ++ Sbjct: 1139 FRGEAITFKATTAGILATLEHCLD-LMG-KREDYWQRRLEREIEKRKKAEASVKESVVSA 1196 Query: 237 QRH 229 ++H Sbjct: 1197 KKH 1199 >SB_36211| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1020 Score = 27.1 bits (57), Expect = 9.4 Identities = 16/57 (28%), Positives = 22/57 (38%), Gaps = 1/57 (1%) Frame = -2 Query: 256 CQNFDPAKAYSCPQASCEHP-IIYCAPGLWQAH*LLSEISIRWRSSWTCQEEEPPQG 89 C NFD + C S H IYC G L +++ W C+ + P G Sbjct: 953 CMNFDGG--FGCRPGSESHAGQIYCCLGALSITHSLHHVNVDMLGWWLCERQLPSGG 1007 >SB_34026| Best HMM Match : PLDc (HMM E-Value=0.063) Length = 499 Score = 27.1 bits (57), Expect = 9.4 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = +3 Query: 318 SPQSSDQAHNRVSSVFHPVLQYEPDDVEGHYLRTISWGPS 437 SP+ +D H VSSV LQ DD H L+ ++ PS Sbjct: 219 SPEVADFFHELVSSVSDISLQLHKDDTT-HMLKDFAFHPS 257 >SB_34456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 454 Score = 27.1 bits (57), Expect = 9.4 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -2 Query: 358 DETRLCAWSED*GLLGASSADAGVQSW 278 D + CAWS + + +SSAD V W Sbjct: 89 DRVKSCAWSPNGEYVASSSADGRVTLW 115 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,889,975 Number of Sequences: 59808 Number of extensions: 349067 Number of successful extensions: 3803 Number of sequences better than 10.0: 54 Number of HSP's better than 10.0 without gapping: 3711 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3800 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -