BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS311D01f (468 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g13340.1 68418.m01535 expressed protein 27 4.8 At3g19310.1 68416.m02449 expressed protein similar to GB:CAB1679... 27 8.4 >At5g13340.1 68418.m01535 expressed protein Length = 242 Score = 27.5 bits (58), Expect = 4.8 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = -2 Query: 458 EKERASRRRNLAEETVPRNSNRL 390 +KE A+RR+ L EE RNS++L Sbjct: 204 QKEEAARRKKLEEEEEIRNSSKL 226 >At3g19310.1 68416.m02449 expressed protein similar to GB:CAB16796 from [Arabidopsis thaliana] Length = 413 Score = 26.6 bits (56), Expect = 8.4 Identities = 12/39 (30%), Positives = 18/39 (46%), Gaps = 3/39 (7%) Frame = +3 Query: 45 LFGFQLWPSAGAAWPSVQPLECENEN---FELNPQNTTS 152 +F P G WP++ + C+N+ F NPQ S Sbjct: 197 MFPVSRMPKNGEDWPTLDDMICQNQRLLVFTSNPQKEAS 235 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,425,649 Number of Sequences: 28952 Number of extensions: 176372 Number of successful extensions: 438 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 432 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 438 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 791932800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -