BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS311C11f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 25 0.36 AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 23 2.5 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 25.4 bits (53), Expect = 0.36 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +3 Query: 9 PRREASSVPREGTSARPLPRREAHPVPSRK 98 P E S + + S PLPR+ +PV K Sbjct: 2 PSSEFSKISKVDRSTSPLPRKPVNPVQELK 31 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 22.6 bits (46), Expect = 2.5 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -1 Query: 413 VRSKDVEYVRIWNPTTIL 360 +R V Y R+W P TIL Sbjct: 77 IRVIRVPYNRVWRPDTIL 94 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 112,943 Number of Sequences: 438 Number of extensions: 2057 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -