BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS311C08f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974162-1|ABJ52802.1| 418|Anopheles gambiae serpin 3 protein. 23 4.7 AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase ... 23 8.2 >DQ974162-1|ABJ52802.1| 418|Anopheles gambiae serpin 3 protein. Length = 418 Score = 23.4 bits (48), Expect = 4.7 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = +2 Query: 335 YHTIYTPLYIFTTRLVLFQNSLSLRAKTSDYF*RHT 442 YH+I Y TT+ V FQ++ S A+ + + ++T Sbjct: 140 YHSIIAARYNATTQSVDFQDTQSAAAEINAWIAQNT 175 >AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase protein. Length = 808 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +2 Query: 329 TVYHTIYTPLYIFTTRLVLFQNSLSLR 409 TVY PL++ T ++F NS ++ Sbjct: 498 TVYWYGLDPLWMLATNKIIFLNSFKMK 524 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 360,914 Number of Sequences: 2352 Number of extensions: 5456 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -