BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS311C07f (404 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC29A3.12 |rps902|rps9-2, rps9b|40S ribosomal protein S9|Schiz... 34 0.010 SPAC24H6.07 |rps901|rps9-1, rps9a|40S ribosomal protein S9|Schiz... 34 0.010 SPBC16E9.08 |mcp4|mug101|sequence orphan|Schizosaccharomyces pom... 26 2.6 SPCC162.01c |||RNA-binding protein |Schizosaccharomyces pombe|ch... 25 3.4 SPBC12C2.07c |||spermidine synthase |Schizosaccharomyces pombe|c... 25 3.4 SPCC1281.06c |||acyl-coA desaturase |Schizosaccharomyces pombe|c... 25 5.9 SPAC12G12.11c |||DUF544 family protein|Schizosaccharomyces pombe... 25 5.9 SPAC26F1.06 |gpm1||monomeric 2,3-bisphosphoglycerate |Schizosacc... 25 5.9 >SPBC29A3.12 |rps902|rps9-2, rps9b|40S ribosomal protein S9|Schizosaccharomyces pombe|chr 2|||Manual Length = 192 Score = 33.9 bits (74), Expect = 0.010 Identities = 13/23 (56%), Positives = 20/23 (86%) Frame = +1 Query: 334 IRHEGEVWRVKYTLARIRKAARE 402 +R++ E+WRV TL++IR+AARE Sbjct: 36 LRNKHEIWRVALTLSKIRRAARE 58 >SPAC24H6.07 |rps901|rps9-1, rps9a|40S ribosomal protein S9|Schizosaccharomyces pombe|chr 1|||Manual Length = 191 Score = 33.9 bits (74), Expect = 0.010 Identities = 13/23 (56%), Positives = 20/23 (86%) Frame = +1 Query: 334 IRHEGEVWRVKYTLARIRKAARE 402 +R++ E+WRV TL++IR+AARE Sbjct: 36 LRNKHEIWRVALTLSKIRRAARE 58 >SPBC16E9.08 |mcp4|mug101|sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 355 Score = 25.8 bits (54), Expect = 2.6 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +1 Query: 292 AKSCLSDNLNTSCRIRHEGEVWRVK 366 A L DNL +C + EGEV VK Sbjct: 166 ASEVLKDNLLQTCNSKREGEVCDVK 190 >SPCC162.01c |||RNA-binding protein |Schizosaccharomyces pombe|chr 3|||Manual Length = 244 Score = 25.4 bits (53), Expect = 3.4 Identities = 14/47 (29%), Positives = 23/47 (48%), Gaps = 5/47 (10%) Frame = -2 Query: 277 RQHSRQGQRDRGPKLPKGQMERHR-----QLKRPPVRHKRQGQQRMQ 152 R++ +RD P + + ERHR + R PV H+R Q ++ Sbjct: 47 RRYEDSQRRDYSPARRRDRYERHRESVREESPRRPVEHERNWQPELK 93 >SPBC12C2.07c |||spermidine synthase |Schizosaccharomyces pombe|chr 2|||Manual Length = 298 Score = 25.4 bits (53), Expect = 3.4 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 378 SERVFDAPYFTLVPNSARGIQVVT*TGFC 292 +E +F PYF L+ ++ RG V+T C Sbjct: 176 AEALFQKPYFQLLSDALRGGGVITTQAEC 204 >SPCC1281.06c |||acyl-coA desaturase |Schizosaccharomyces pombe|chr 3|||Manual Length = 479 Score = 24.6 bits (51), Expect = 5.9 Identities = 6/8 (75%), Positives = 7/8 (87%) Frame = +2 Query: 80 HWWRHLQW 103 +WWRHL W Sbjct: 57 NWWRHLNW 64 >SPAC12G12.11c |||DUF544 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 365 Score = 24.6 bits (51), Expect = 5.9 Identities = 14/52 (26%), Positives = 25/52 (48%) Frame = +3 Query: 3 QNDENYLSHLCAGRHRRGQADTFKRTIGGGTCSGNRNKLSVLPSHQQRISCI 158 ++DE Y L RG+ +T K+ + + RNK + S +Q +C+ Sbjct: 316 KDDEQYAKRLAKEEEERGKKETPKK----ASNTPRRNKSNTQKSRKQSENCL 363 >SPAC26F1.06 |gpm1||monomeric 2,3-bisphosphoglycerate |Schizosaccharomyces pombe|chr 1|||Manual Length = 211 Score = 24.6 bits (51), Expect = 5.9 Identities = 14/30 (46%), Positives = 21/30 (70%), Gaps = 2/30 (6%) Frame = -3 Query: 393 SLTDTSERVFDAPYF--TLVPNSARGIQVV 310 SL DT+ERV PY+ T+VP+ +G +V+ Sbjct: 132 SLKDTAERVL--PYYKSTIVPHILKGEKVL 159 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,319,613 Number of Sequences: 5004 Number of extensions: 22926 Number of successful extensions: 76 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 76 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 76 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 138190552 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -