BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS311C05f (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP35G2.14 |||RNA-binding protein|Schizosaccharomyces pombe|chr... 28 0.97 SPBC36B7.09 |gcn2|ppk28, ppk28, SPBP18G5.01|eIF2 alpha kinase Gc... 25 5.2 SPAC17A2.09c |csx1||RNA-binding protein Csx1|Schizosaccharomyces... 25 6.8 SPAC1093.01 ||SPAC12B10.18|PPR repeat protein|Schizosaccharomyce... 25 6.8 SPCC1494.10 ||SPCC70.01|transcription factor |Schizosaccharomyce... 25 9.0 SPAC15E1.07c |moa1|mug159|meiotic cohesin complex associated pro... 25 9.0 >SPBP35G2.14 |||RNA-binding protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 1060 Score = 27.9 bits (59), Expect = 0.97 Identities = 14/51 (27%), Positives = 19/51 (37%) Frame = +2 Query: 176 KKKMACATLKRNLDWESKAQLPTKRRRCSPFAASPSTSPGLKTSESKPSSF 328 + + T L W + PT PF P+TS L + SSF Sbjct: 244 RARQTTRTRSNTLPWSPRVFGPTLGYNTPPFGYPPTTSSALPNASGSSSSF 294 >SPBC36B7.09 |gcn2|ppk28, ppk28, SPBP18G5.01|eIF2 alpha kinase Gcn2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1576 Score = 25.4 bits (53), Expect = 5.2 Identities = 7/31 (22%), Positives = 19/31 (61%) Frame = +1 Query: 247 EKKMFTICSKSKHKSWVKNIRIETIFIWRIR 339 +KK+ T+ + K + W+ + R I+++ ++ Sbjct: 1546 QKKLVTLAEQDKKRVWICSFRTNEIYLYGLK 1576 >SPAC17A2.09c |csx1||RNA-binding protein Csx1|Schizosaccharomyces pombe|chr 1|||Manual Length = 632 Score = 25.0 bits (52), Expect = 6.8 Identities = 12/26 (46%), Positives = 17/26 (65%), Gaps = 2/26 (7%) Frame = +2 Query: 221 ESKAQL--PTKRRRCSPFAASPSTSP 292 E K++L PT R +PF SPS++P Sbjct: 47 EGKSELVSPTLERLVAPFNCSPSSTP 72 >SPAC1093.01 ||SPAC12B10.18|PPR repeat protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 1261 Score = 25.0 bits (52), Expect = 6.8 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +2 Query: 305 SESKPSSFGESVSAPVKITPERMAQEIYDEIKR 403 S +PS++ V A + + R A EI +++KR Sbjct: 1177 SGKEPSTYENMVRAYLSVNDGRKAMEIVEQLKR 1209 >SPCC1494.10 ||SPCC70.01|transcription factor |Schizosaccharomyces pombe|chr 3|||Manual Length = 964 Score = 24.6 bits (51), Expect = 9.0 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 4/45 (8%) Frame = +2 Query: 221 ESKAQLPTKRRRCSPFAAS----PSTSPGLKTSESKPSSFGESVS 343 ESK Q+P K + F+ S PS P +S + PS ES+S Sbjct: 61 ESKIQIP-KSSSSTAFSPSNNNAPSPFPPKNSSLASPSKISESIS 104 >SPAC15E1.07c |moa1|mug159|meiotic cohesin complex associated protein Moa1|Schizosaccharomyces pombe|chr 1|||Manual Length = 172 Score = 24.6 bits (51), Expect = 9.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -3 Query: 120 EYKKMKNNIKPHTGNTRKKYTIR 52 EYK +K N P N++KK + R Sbjct: 10 EYKLIKKNKNPKISNSKKKNSTR 32 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,214,389 Number of Sequences: 5004 Number of extensions: 45029 Number of successful extensions: 133 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 129 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 133 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -