Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ovS311C01f
         (418 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g16900.1 68414.m02047 curculin-like (mannose-binding) lectin ...    27   5.1  

>At1g16900.1 68414.m02047 curculin-like (mannose-binding) lectin
           family protein very low similarity to Ser Thr protein
           kinase GI:2598067 from (Zea mays); contains Pfam lectin
           (probable mannose binding) domain PF01453
          Length = 919

 Score = 27.1 bits (57), Expect = 5.1
 Identities = 11/34 (32%), Positives = 21/34 (61%)
 Frame = -2

Query: 408 FNQASNPSKTKQCDAQAYHKFYKIXLVVYTX*KY 307
           +++A  P K K CD +++H +Y++  V +   KY
Sbjct: 306 WSKACKPKKVKSCDPKSFH-YYRLGGVEHFMTKY 338


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 7,056,592
Number of Sequences: 28952
Number of extensions: 105907
Number of successful extensions: 184
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 179
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 184
length of database: 12,070,560
effective HSP length: 74
effective length of database: 9,928,112
effective search space used: 635399168
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)