BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS311B08f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 72 3e-15 AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. 23 1.4 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 72.1 bits (169), Expect = 3e-15 Identities = 32/73 (43%), Positives = 44/73 (60%) Frame = +3 Query: 261 QITVKGRDVPAPSIFFEEGGFPDYAMKEILKQGFPNPTPIQAQGWPIALSGRDMVGIAQT 440 Q+ V G +VP P FE G + + I K G+ PTP+Q PI ++GRD++ AQT Sbjct: 183 QVNVSGDNVPQPIESFEAAGLRNIVLDNIKKSGYKKPTPVQKHALPIIMNGRDLMACAQT 242 Query: 441 GSGKTLAYILPAI 479 GSGKT A+ +P I Sbjct: 243 GSGKTAAFAVPII 255 >AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. Length = 316 Score = 23.4 bits (48), Expect = 1.4 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +3 Query: 285 VPAPSIFFEEGGFPDYAMKEILKQGFPNP 371 + AP+ + G P Y E++KQ P P Sbjct: 205 IGAPNEIDKFYGTPGYTAPEVIKQNRPTP 233 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 138,052 Number of Sequences: 438 Number of extensions: 3148 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -