SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ovS311B04f
         (521 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF514804-1|AAM51823.1|  537|Apis mellifera neuronal nicotinic ac...    21   5.8  

>AF514804-1|AAM51823.1|  537|Apis mellifera neuronal nicotinic
           acetylcholine receptoralpha-3 protein.
          Length = 537

 Score = 21.4 bits (43), Expect = 5.8
 Identities = 12/39 (30%), Positives = 22/39 (56%), Gaps = 1/39 (2%)
 Frame = +1

Query: 1   LTMVYES-DFYTTRRPYRSTYSVTTPRHYVVVDRDPIAP 114
           L +++++   Y TR P     S  +PR+Y+  + D I+P
Sbjct: 498 LGIIFQAPSLYDTREPVDQQLSGISPRNYMYPNID-ISP 535


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 99,372
Number of Sequences: 438
Number of extensions: 1487
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 14600229
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -