BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS311B02f (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC2G11.12 |rqh1|hus2, rad12, rec9|RecQ type DNA helicase Rqh1|... 26 3.9 SPBC1861.04c |||RNA-binding protein Prp24|Schizosaccharomyces po... 25 6.8 SPAC8F11.04 |||U3 snoRNP-associated protein Cic1/Utp30 family |S... 25 9.0 >SPAC2G11.12 |rqh1|hus2, rad12, rec9|RecQ type DNA helicase Rqh1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1328 Score = 25.8 bits (54), Expect = 3.9 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 69 PIMSQAHYKEVQSCLKKKLHIR 134 P++S KEV CLK K H++ Sbjct: 497 PMLSYPWSKEVLGCLKHKFHLK 518 >SPBC1861.04c |||RNA-binding protein Prp24|Schizosaccharomyces pombe|chr 2|||Manual Length = 1014 Score = 25.0 bits (52), Expect = 6.8 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +3 Query: 6 RLKKPHE*LSPPMPHYATFVRPIMSQAHYKEV 101 RLK PHE + +TFV S + Y++V Sbjct: 207 RLKLPHEQIEETFTSLSTFVTNNWSPSEYEDV 238 >SPAC8F11.04 |||U3 snoRNP-associated protein Cic1/Utp30 family |Schizosaccharomyces pombe|chr 1|||Manual Length = 373 Score = 24.6 bits (51), Expect = 9.0 Identities = 13/53 (24%), Positives = 26/53 (49%) Frame = +3 Query: 102 QSCLKKKLHIRCLKVPQKLSRGQGVKVLDSCPEEAGLLASSNPFILQNVLRSH 260 Q + K + +VP+KLS K + + G A ++P + Q+ L+++ Sbjct: 304 QQNVSDKKQVTVKEVPKKLSVKNAAKTTNRDEDSKGKKAKASPKVSQSSLKAN 356 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,992,825 Number of Sequences: 5004 Number of extensions: 38484 Number of successful extensions: 71 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 69 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 71 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -